BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31381 (709 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g45976.1 68414.m05206 expressed protein 30 1.3 At5g16780.1 68418.m01965 SART-1 family protein contains Pfam dom... 29 3.0 At3g43800.1 68416.m04681 glutathione S-transferase, putative glu... 29 3.0 At2g18540.1 68415.m02160 cupin family protein contains Pfam prof... 29 3.0 At5g48040.1 68418.m05936 hypothetical protein 28 5.3 At5g44030.1 68418.m05388 cellulose synthase, catalytic subunit (... 28 5.3 At3g27710.1 68416.m03460 zinc finger protein-related contains si... 28 5.3 At1g62040.1 68414.m06997 autophagy 8c (APG8c) identical to autop... 28 5.3 At3g28770.1 68416.m03591 expressed protein 28 7.0 At3g53350.3 68416.m05888 myosin heavy chain-related low similari... 27 9.2 At3g53350.2 68416.m05887 myosin heavy chain-related low similari... 27 9.2 At3g53350.1 68416.m05886 myosin heavy chain-related low similari... 27 9.2 At1g76780.1 68414.m08935 expressed protein ; expression supporte... 27 9.2 >At1g45976.1 68414.m05206 expressed protein Length = 325 Score = 30.3 bits (65), Expect = 1.3 Identities = 23/83 (27%), Positives = 37/83 (44%) Frame = -3 Query: 695 KRQDYDLKELKERQKQQLRHKALKKGLDPEALTGKHPPKIQVASKYERRVDTRSYDDKKK 516 +RQD D+ + Q QLRH L K + T + V E+ + + K K Sbjct: 144 QRQDADIDRFLKIQGDQLRHAILDKIKRGQQKTVSLMEEKVVQKLREKDEELERINRKNK 203 Query: 515 LFEGDLEKLNKDFLEKVWQERAE 447 E +E+L + + WQ+RA+ Sbjct: 204 ELEVRMEQLTME--AEAWQQRAK 224 >At5g16780.1 68418.m01965 SART-1 family protein contains Pfam domain, PF03343: SART-1 family Length = 820 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/76 (25%), Positives = 37/76 (48%), Gaps = 1/76 (1%) Frame = -3 Query: 707 EERQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTGKHPPKI-QVASKYERRVDTRSY 531 +ER+K + D + K+++K++ RHK + D E K ++ + ASK D ++ Sbjct: 84 KEREKDKSRDRVKEKDKEKERNRHKDRENERDNEKEKDKDRARVKERASKKSHEDDDETH 143 Query: 530 DDKKKLFEGDLEKLNK 483 ++ D LN+ Sbjct: 144 KAAERYEHSDNRGLNE 159 >At3g43800.1 68416.m04681 glutathione S-transferase, putative glutathione transferase, papaya, PIR:T09781 Length = 227 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +1 Query: 121 KLMDWLQNCRTRPA 162 KLMDW++ C TRPA Sbjct: 186 KLMDWIRKCLTRPA 199 >At2g18540.1 68415.m02160 cupin family protein contains Pfam profile PF00190: Cupin Length = 707 Score = 29.1 bits (62), Expect = 3.0 Identities = 25/115 (21%), Positives = 53/115 (46%), Gaps = 1/115 (0%) Frame = -3 Query: 707 EERQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTGKHPP-KIQVASKYERRVDTRSY 531 EER+K ++ K +ERQ+++ K+ + E + K + K E + R Sbjct: 521 EEREKEEEMAKKREEERQRKEREEVERKRREEQERKRREEEARKREEERKREEEMAKRRE 580 Query: 530 DDKKKLFEGDLEKLNKDFLEKVWQERAEQFGGRQKARLPKWFGERPGKKKGELES 366 ++++ + E++ + E+ ++R E+ R++ K E +KK E E+ Sbjct: 581 QERQR---KEREEVERKIREEQERKREEEMAKRREQERQKKEREEMERKKREEEA 632 >At5g48040.1 68418.m05936 hypothetical protein Length = 422 Score = 28.3 bits (60), Expect = 5.3 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Frame = -3 Query: 629 LKKGLDPEALTGKHPPKIQVASKYERRVDTRSYDDKKKLF----EGDLEKLNKDFLEKVW 462 L++ D L KHP ++V K+ ++ D + L+ E DLEK N VW Sbjct: 335 LREAYDRRHLIEKHP-LVEVREKFANMMNEGFLDRSRGLYQKSVEADLEKNNIKTSYPVW 393 Query: 461 QERAEQ 444 + E+ Sbjct: 394 SDEEEE 399 >At5g44030.1 68418.m05388 cellulose synthase, catalytic subunit (IRX5) nearly identical to cellulose synthase [Arabidopsis thaliana] GI:27462651; contains Pfam profile PF03552: Cellulose synthase Length = 1049 Score = 28.3 bits (60), Expect = 5.3 Identities = 16/66 (24%), Positives = 31/66 (46%) Frame = -3 Query: 566 SKYERRVDTRSYDDKKKLFEGDLEKLNKDFLEKVWQERAEQFGGRQKARLPKWFGERPGK 387 SK + R + R++ + D E + + W+ER +++ RQ+ R GE+ + Sbjct: 123 SKQQWRPNGRAFSSTGSVLGKDFEAERDGYTDAEWKERVDKWKARQEKRGLVTKGEQTNE 182 Query: 386 KKGELE 369 K + E Sbjct: 183 DKEDDE 188 >At3g27710.1 68416.m03460 zinc finger protein-related contains similarity to zinc finger proteins and Pfam domain, PF01485: IBR domain Length = 537 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/37 (35%), Positives = 25/37 (67%) Frame = -3 Query: 566 SKYERRVDTRSYDDKKKLFEGDLEKLNKDFLEKVWQE 456 S+ ER + ++D+++ EG++EKL+K LE+ + E Sbjct: 429 SEKEREIKKNLFEDQQQQLEGNVEKLSK-ILEEPFDE 464 >At1g62040.1 68414.m06997 autophagy 8c (APG8c) identical to autophagy 8c [Arabidopsis thaliana] GI:19912155; contains Pfam profile PF02991: Microtubule associated protein 1A/1B, light chain 3 Length = 119 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -3 Query: 647 QLRHKALKKGLDPEALTGKHPPKIQVASKYERRVDTRSYDDKKKLFEGDL 498 +L H ++ ++ + K+P +I V + R D + D KK L DL Sbjct: 7 KLEHPLERRQIESSRIREKYPDRIPVIVERAERSDVPNIDKKKYLVPADL 56 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 27.9 bits (59), Expect = 7.0 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 4/91 (4%) Frame = -3 Query: 707 EERQKRQDYDLKELKERQKQQLRHKALKKG-LDPEALTGKHPPKIQVASKYERRVDTRSY 531 ++++K+ D ++ KE++ ++ K LKK D + T K Q +K E+ + Sbjct: 1179 DKKEKKSSKDQQKKKEKEMKESEEKKLKKNEEDRKKQTSVEENKKQKETKKEK---NKPK 1235 Query: 530 DDKK---KLFEGDLEKLNKDFLEKVWQERAE 447 DDKK K G E + + E Q++++ Sbjct: 1236 DDKKNTTKQSGGKKESMESESKEAENQQKSQ 1266 >At3g53350.3 68416.m05888 myosin heavy chain-related low similarity to filamin-interacting protein S-FILIP [Rattus norvegicus] GI:21392397, nonmuscle heavy chain myosin II-A [Mus musculus] GI:17978023 Length = 394 Score = 27.5 bits (58), Expect = 9.2 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = -3 Query: 674 KELKERQKQQLRHKALKKGLDPEALTGKHPPKIQVASKYERRVDTRSY-DDKKKLFEGDL 498 +ELK+ +++ R +ALK+ EA KH AS+ R + R ++ K ++ +L Sbjct: 83 EELKKAKEELNRSEALKREAQEEAEDAKHQLMDINASEDSRIEELRKLSQERDKTWQSEL 142 Query: 497 EKLNK 483 E + + Sbjct: 143 EAMQR 147 >At3g53350.2 68416.m05887 myosin heavy chain-related low similarity to filamin-interacting protein S-FILIP [Rattus norvegicus] GI:21392397, nonmuscle heavy chain myosin II-A [Mus musculus] GI:17978023 Length = 394 Score = 27.5 bits (58), Expect = 9.2 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = -3 Query: 674 KELKERQKQQLRHKALKKGLDPEALTGKHPPKIQVASKYERRVDTRSY-DDKKKLFEGDL 498 +ELK+ +++ R +ALK+ EA KH AS+ R + R ++ K ++ +L Sbjct: 83 EELKKAKEELNRSEALKREAQEEAEDAKHQLMDINASEDSRIEELRKLSQERDKTWQSEL 142 Query: 497 EKLNK 483 E + + Sbjct: 143 EAMQR 147 >At3g53350.1 68416.m05886 myosin heavy chain-related low similarity to filamin-interacting protein S-FILIP [Rattus norvegicus] GI:21392397, nonmuscle heavy chain myosin II-A [Mus musculus] GI:17978023 Length = 396 Score = 27.5 bits (58), Expect = 9.2 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = -3 Query: 674 KELKERQKQQLRHKALKKGLDPEALTGKHPPKIQVASKYERRVDTRSY-DDKKKLFEGDL 498 +ELK+ +++ R +ALK+ EA KH AS+ R + R ++ K ++ +L Sbjct: 85 EELKKAKEELNRSEALKREAQEEAEDAKHQLMDINASEDSRIEELRKLSQERDKTWQSEL 144 Query: 497 EKLNK 483 E + + Sbjct: 145 EAMQR 149 >At1g76780.1 68414.m08935 expressed protein ; expression supported by MPSS Length = 1871 Score = 27.5 bits (58), Expect = 9.2 Identities = 29/98 (29%), Positives = 42/98 (42%), Gaps = 2/98 (2%) Frame = -3 Query: 698 QKRQDY--DLKELKERQKQQLRHKALKKGLDPEALTGKHPPKIQVASKYERRVDTRSYDD 525 QKR D ++KEL+E Q + L P + KIQ + E Y++ Sbjct: 464 QKRHDKQENIKELREGQASEAEKNIKNDILKPVQKRSEGKHKIQKTFQEETNKQPEGYNE 523 Query: 524 KKKLFEGDLEKLNKDFLEKVWQERAEQFGGRQKARLPK 411 K+ E +K+N+D KV QE Q + AR K Sbjct: 524 --KIMETG-KKINEDGTRKV-QEMIRQQELDEPARSEK 557 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,204,788 Number of Sequences: 28952 Number of extensions: 147174 Number of successful extensions: 657 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -