BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31380 (579 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g23110.1 68418.m02703 zinc finger (C3HC4-type RING finger) fa... 28 5.2 At5g09910.1 68418.m01146 GTP-binding protein-related contains we... 27 6.8 At4g24290.2 68417.m03488 expressed protein 27 6.8 At4g24290.1 68417.m03487 expressed protein 27 6.8 At3g44060.1 68416.m04720 F-box family protein contains F-box dom... 27 6.8 At1g48120.1 68414.m05370 calcineurin-like phosphoesterase family... 27 6.8 At1g18990.1 68414.m02362 expressed protein contains Pfam profile... 27 6.8 At4g08160.1 68417.m01347 glycosyl hydrolase family 10 protein / ... 27 9.0 At1g63700.1 68414.m07209 protein kinase, putative contains prote... 27 9.0 >At5g23110.1 68418.m02703 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 4706 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 249 GSYSYTNTDGKPETITYFADETGYHAQGESIP 344 GS++ N +G E I +FA+E GY +S+P Sbjct: 1985 GSFTTFNKNGTAERI-FFAEEIGYELLKDSLP 2015 >At5g09910.1 68418.m01146 GTP-binding protein-related contains weak similarity to GTP-binding protein yptV3. (Swiss-Prot:P36862) [Volvox carteri] Length = 431 Score = 27.5 bits (58), Expect = 6.8 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -3 Query: 565 FLYQMNFIVFVHDILKTQQIVKKNVQK 485 F Q+N ++FVHD+ +Q+ K N+QK Sbjct: 91 FYSQINGVIFVHDL--SQRTTKTNLQK 115 >At4g24290.2 68417.m03488 expressed protein Length = 606 Score = 27.5 bits (58), Expect = 6.8 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 149 VVVSSIGAGVEFRPNDLRVVLCRGGSDD 66 V + SIG G + DLR+ C+GGS D Sbjct: 13 VAIGSIGCGYDLAI-DLRLKYCKGGSKD 39 >At4g24290.1 68417.m03487 expressed protein Length = 350 Score = 27.5 bits (58), Expect = 6.8 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 149 VVVSSIGAGVEFRPNDLRVVLCRGGSDD 66 V + SIG G + DLR+ C+GGS D Sbjct: 13 VAIGSIGCGYDLAI-DLRLKYCKGGSKD 39 >At3g44060.1 68416.m04720 F-box family protein contains F-box domain Pfam:PF00646 Length = 427 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 124 PAPMELTTTISRLPTASCVAKL 189 P M+LT + +LPTASC K+ Sbjct: 403 PKKMQLTEDLLKLPTASCKLKI 424 >At1g48120.1 68414.m05370 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 1338 Score = 27.5 bits (58), Expect = 6.8 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +3 Query: 144 NYNFETSNGIVR---SETGELKEALDDD-NKPHVIVAVRGSYSYTNTDGKPETIT 296 +++ +T NG SET E+ + L D KP RG+Y TD K ++ T Sbjct: 1053 DFSDKTENGSKEADHSETAEISKDLSDTVGKPESCSRTRGTYEAIGTDAKLKSNT 1107 >At1g18990.1 68414.m02362 expressed protein contains Pfam profile PF04576: Protein of unknown function, DUF593 Length = 524 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 168 GIVRSETGELKEALDDDNKP 227 G++R E GE +E LD++ KP Sbjct: 401 GLLREERGEAEEFLDEETKP 420 >At4g08160.1 68417.m01347 glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein ; contains Pfam profiles PF00331: Glycosyl hydrolase family 10, PF02018: Carbohydrate binding domain Length = 752 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +1 Query: 328 RVNLFLRSPPPRAK-LLNSL 384 RV L+L PPPRA LLNSL Sbjct: 154 RVILYLEGPPPRADILLNSL 173 >At1g63700.1 68414.m07209 protein kinase, putative contains protein kinase domain, Pfam:PF00069; similar to MEK kinase (MAP3Ka) [Arabidopsis thaliana] gi|4204912|gb|AAD10848 Length = 883 Score = 27.1 bits (57), Expect = 9.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 326 SMVSSLVSEVRNGFRFAVSVRVTVASTHSNNN 231 S++S L S+ NG R V++ S HSN N Sbjct: 157 SLLSPLASDCENGNRTPVNISSRDQSMHSNKN 188 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,144,331 Number of Sequences: 28952 Number of extensions: 212665 Number of successful extensions: 686 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -