BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31379 (432 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38360.2 68417.m05424 expressed protein contains Pfam profile... 31 0.34 At4g10210.1 68417.m01674 hypothetical protein IB1C3-1 protein, A... 28 2.4 At4g27585.1 68417.m03962 band 7 family protein similar to stomat... 28 3.1 At3g13784.1 68416.m01741 beta-fructosidase, putative / beta-fruc... 28 3.1 At5g66120.2 68418.m08330 3-dehydroquinate synthase, putative sim... 27 5.5 At5g66120.1 68418.m08329 3-dehydroquinate synthase, putative sim... 27 5.5 At3g52200.1 68416.m05733 dihydrolipoamide S-acetyltransferase, p... 27 5.5 At5g63260.1 68418.m07940 zinc finger (CCCH-type) family protein ... 27 7.2 At1g68020.2 68414.m07771 glycosyl transferase family 20 protein ... 26 9.6 At1g68020.1 68414.m07770 glycosyl transferase family 20 protein ... 26 9.6 >At4g38360.2 68417.m05424 expressed protein contains Pfam profile PF03619: Domain of unknown function Length = 485 Score = 31.1 bits (67), Expect = 0.34 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -3 Query: 166 DNCKPQSPARRSFSGLPGPLGQGEHADSFSVARVRPRTSKGIT 38 D+C SP+RR G+ PL G +DS + R G T Sbjct: 415 DSCMSSSPSRRVIRGIDDPLLNGSFSDSGVTRTKKHRRKSGYT 457 >At4g10210.1 68417.m01674 hypothetical protein IB1C3-1 protein, Arabidopsis thaliana, AJ011845 contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 375 Score = 28.3 bits (60), Expect = 2.4 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = -3 Query: 196 ALTRNSSFMGDNCKPQSPARRSFSGLPGPLGQGEHADSFSVARVRPRTSKGI 41 AL + SF GDN PQS +++ P G H + +PR G+ Sbjct: 141 ALLKMKSFDGDNSNPQSSWSKTYK--PTSSNGGHHFAVVRTTKGKPRRYNGV 190 >At4g27585.1 68417.m03962 band 7 family protein similar to stomatin-like protein [Zea mays] GI:7716464; contains Pfam profile PF01145: SPFH domain / Band 7 family Length = 411 Score = 27.9 bits (59), Expect = 3.1 Identities = 17/76 (22%), Positives = 35/76 (46%) Frame = +3 Query: 3 LRAARXLSNNRSVMPLDVLGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEE 182 LR+ L + P + +T+++ + +P N +L +WG+++ P + Sbjct: 15 LRSVSYLRQSAVTSPPPIFSAAASTVRQFTSAGYP---SNSFQLTPPTNWGIRIVPERKA 71 Query: 183 FLVSASHKLALITSLP 230 F++ K A T+LP Sbjct: 72 FVIERFGKYA--TTLP 85 >At3g13784.1 68416.m01741 beta-fructosidase, putative / beta-fructofuranosidase, putative / cell wall invertase, putative similar to beta-fructofuranosidase GI:402740 from [Arabidopsis thaliana] Length = 569 Score = 27.9 bits (59), Expect = 3.1 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 35 VCDALRCPGPHARYTEGISMFSL--A*RPGQPAETPSCWGLGFAIIPHKRGI 184 V D + HA T+ I+ +L A RP +P++ CW I+P+ + + Sbjct: 77 VMDVNKTVWGHATSTDLINWITLSPAIRPSRPSDINGCWSGSVTILPNGKPV 128 >At5g66120.2 68418.m08330 3-dehydroquinate synthase, putative similar to aroB [Neisseria gonorrhoeae][GI:2661441]; contains 3-dehydroquinate synthase domain PF01761 Length = 442 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -1 Query: 339 SLVNFPTTPTAVKPPRVGPKTSLNHSIGSS 250 + + PTT A VG KT +NH +G + Sbjct: 202 NFIQIPTTVMAQVDSSVGGKTGINHRLGKN 231 >At5g66120.1 68418.m08329 3-dehydroquinate synthase, putative similar to aroB [Neisseria gonorrhoeae][GI:2661441]; contains 3-dehydroquinate synthase domain PF01761 Length = 338 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -1 Query: 339 SLVNFPTTPTAVKPPRVGPKTSLNHSIGSS 250 + + PTT A VG KT +NH +G + Sbjct: 98 NFIQIPTTVMAQVDSSVGGKTGINHRLGKN 127 >At3g52200.1 68416.m05733 dihydrolipoamide S-acetyltransferase, putative similar to dihydrolipoamide acetyltransferase (E2) subunit of PDC [Arabidopsis thaliana] GI:559395; contains Pfam profiles PF00198: 2-oxo acid dehydrogenases acyltransferase (catalytic domain), PF00364: Biotin-requiring enzyme, PF02817: e3 binding domain; supporting cDNA gi|5881964|gb|AF066080.1|AF066080 Length = 637 Score = 27.1 bits (57), Expect = 5.5 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +2 Query: 251 LLPIE*FSEVFGPTRGGFTAVG----VVGKLTKLDHLEEVKVVTR 373 + P++ F + P + G AVG VV + LD +E+ VVT+ Sbjct: 557 MYPVDNFCAIINPPQAGILAVGRGNKVVEPVIGLDGIEKPSVVTK 601 >At5g63260.1 68418.m07940 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 435 Score = 26.6 bits (56), Expect = 7.2 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -3 Query: 187 RNSSF-MGDNCKPQSPARRSFSGLPGPLGQGEHADSFS 77 RN S G +CK P + G+ PL +G + SFS Sbjct: 205 RNGSCKFGSDCKFNHPDPTAIGGVDSPLYRGNNGGSFS 242 >At1g68020.2 68414.m07771 glycosyl transferase family 20 protein / trehalose-phosphatase family protein similar to SP|Q00764 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit (EC 2.4.1.15) (Trehalose-6-phosphate synthase) {Saccharomyces cerevisiae}; contains Pfam profile: PF02358 trehalose-phosphatase Length = 860 Score = 26.2 bits (55), Expect = 9.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 304 HGRRRCWEVDQT*SFR 351 HGRRRCW + SFR Sbjct: 562 HGRRRCWGIGFGLSFR 577 >At1g68020.1 68414.m07770 glycosyl transferase family 20 protein / trehalose-phosphatase family protein similar to SP|Q00764 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit (EC 2.4.1.15) (Trehalose-6-phosphate synthase) {Saccharomyces cerevisiae}; contains Pfam profile: PF02358 trehalose-phosphatase Length = 700 Score = 26.2 bits (55), Expect = 9.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 304 HGRRRCWEVDQT*SFR 351 HGRRRCW + SFR Sbjct: 562 HGRRRCWGIGFGLSFR 577 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,849,242 Number of Sequences: 28952 Number of extensions: 203662 Number of successful extensions: 478 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 685039728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -