BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31374 (647 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 32 0.35 SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) 31 1.1 SB_13178| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_34358| Best HMM Match : DUF1280 (HMM E-Value=7) 30 1.9 SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) 30 1.9 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_1509| Best HMM Match : SRR (HMM E-Value=0.22) 29 4.3 SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) 28 7.5 SB_27357| Best HMM Match : MFMR (HMM E-Value=3.2) 27 9.9 SB_26971| Best HMM Match : Peptidase_C5 (HMM E-Value=0.13) 27 9.9 SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) 27 9.9 SB_50281| Best HMM Match : Utp21 (HMM E-Value=1.1) 27 9.9 SB_11039| Best HMM Match : Lig_chan (HMM E-Value=1.2) 27 9.9 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 32.3 bits (70), Expect = 0.35 Identities = 20/68 (29%), Positives = 37/68 (54%) Frame = +1 Query: 1 VKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMA 180 V ++ PK ++ P S+ D WM+ +E FV+K+N Q+ + SS F K+ + + Sbjct: 251 VLVWRAPKSSQDALPVSITDRWMSQHE---FVEKLNM-QAVLCASSHTDEFVKDFLITLE 306 Query: 181 EIYKLLDQ 204 +I L+ + Sbjct: 307 KIPVLIHE 314 >SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) Length = 736 Score = 30.7 bits (66), Expect = 1.1 Identities = 27/105 (25%), Positives = 51/105 (48%), Gaps = 10/105 (9%) Frame = +1 Query: 79 ELDWFVQKVNPGQSQIT---RSSTDFAFFKEDSLPMA--EIYKL-LDQGKIPTDMFNSSD 240 E WF Q +N +S + R +T F D +P+ +I + +D+ +IPTD++ SS Sbjct: 404 EGQWFRQLINESESITSLCERINTFFCSLTSDFVPLTTDDILGIPVDESEIPTDLYVSSR 463 Query: 241 ----TMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVV 363 + S + G DG P + + + +E P +E + +++ Sbjct: 464 EAGIALQSIKLRKAGGPDGIP-NIILKTFSFELAPVIAEIYNALL 507 >SB_13178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = +1 Query: 232 SSDTMPSRLMLPKGTYDGFPFQLFV--FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPV 405 +++T P+ +++P GT ++ + PY P P + P S GYP P Sbjct: 93 NTETSPNAVIIPPGTDPQLANLVYPPPSMAPYPPGPNQGTPPPSTQQQPGSGGYPMMYPQ 152 Query: 406 LPQYF 420 P Y+ Sbjct: 153 QPGYY 157 >SB_34358| Best HMM Match : DUF1280 (HMM E-Value=7) Length = 359 Score = 29.9 bits (64), Expect = 1.9 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 10/103 (9%) Frame = +1 Query: 79 ELDWFVQKVNPGQSQIT---RSSTDFAFFKEDSLPMA--EIYKL-LDQGKIPTDMFNSSD 240 E WF Q +N +S + R +T F D +P+ +I + +D+ +IPTD++ SS Sbjct: 255 EGQWFRQLINESESITSLCERINTFFCSLTSDFVPLTTDDILGIPVDESEIPTDLYVSSR 314 Query: 241 ----TMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKS 357 + S + G DG P + + + +E P +E + + Sbjct: 315 EAGIALQSIKLRKAGGPDGIP-NIILKTFSFELAPVIAEIYNA 356 >SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) Length = 867 Score = 29.9 bits (64), Expect = 1.9 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 10/103 (9%) Frame = +1 Query: 79 ELDWFVQKVNPGQSQIT---RSSTDFAFFKEDSLPMA--EIYKL-LDQGKIPTDMFNSSD 240 E WF Q +N +S + R +T F D +P+ +I + +D+ +IPTD++ SS Sbjct: 490 EGQWFRQLINESESITSLCERINTFFCSLTSDFVPLTTDDILGIPVDESEIPTDLYVSSR 549 Query: 241 ----TMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKS 357 + S + G DG P + + + +E P +E + + Sbjct: 550 EAGIALQSIKLRKAGGPDGIP-NIILKTFSFELAPVIAEIYNA 591 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +1 Query: 247 PSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYP 390 PS ++ P+ Y G+PFQ YP P P F + P + P YP Sbjct: 169 PSPVLSPQ-VYRGYPFQ-----YPGTPPPPMYPAFPPIFPSSPPPEYP 210 >SB_1509| Best HMM Match : SRR (HMM E-Value=0.22) Length = 644 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/54 (22%), Positives = 34/54 (62%) Frame = +2 Query: 362 FRTTNHSVIHSIAPFFLSTSNNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRN 523 + T + ++++++ +L+ S L + ++ ST+++NYS + +LT+ +I ++ Sbjct: 155 YLTLSIKLLNTLSKNYLTLSIKLLNTLSKNSSTLRKNYSTLSRNYLTLRRIPQH 208 >SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1894 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 316 PYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKV 450 P+ P + +PF+SV P +PF Q +QP+ F+ V Sbjct: 509 PFRPGQQPQQPFRSVQPPQQPFRADQQTQQPFQSGQQPHQPFRSV 553 Score = 27.5 bits (58), Expect = 9.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 316 PYEPTPKESEPFKSVVPDNKPF 381 P+ P + +PF+SV P +PF Sbjct: 599 PFRPEQQPQQPFRSVQPPQQPF 620 >SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) Length = 378 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 170 YRWPKSTS-SWTKERFLLTCSTPRTLCLQG*CCLRVH 277 Y WP S + +K +F +C+T QG CLR H Sbjct: 265 YEWPLVDSITASKAKFYFSCATNENHKEQGTVCLRFH 301 >SB_27357| Best HMM Match : MFMR (HMM E-Value=3.2) Length = 468 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/65 (26%), Positives = 36/65 (55%) Frame = +2 Query: 362 FRTTNHSVIHSIAPFFLSTSNNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALIS 541 + T + V+++++ + + S N S + +T+ +NYS + +LT + +NY+ L S Sbjct: 76 YLTLSIKVLNTLSKNYSTLSKNYLTLSIKVLNTLSKNYSTLSKNYLT---LSKNYSTL-S 131 Query: 542 KSKRT 556 K+ T Sbjct: 132 KNYST 136 >SB_26971| Best HMM Match : Peptidase_C5 (HMM E-Value=0.13) Length = 553 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 418 FKQPNMFFKKVLVYHEGELFPY 483 FKQ N++ VLV +G+L+PY Sbjct: 99 FKQVNVWVNGVLVKAQGDLYPY 120 >SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) Length = 245 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +1 Query: 259 MLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYP 390 +L Y G+PFQ YP P P F + P + P YP Sbjct: 172 VLSPQVYRGYPFQ-----YPGTPPPPMYPAFPPIFPSSPPPEYP 210 >SB_50281| Best HMM Match : Utp21 (HMM E-Value=1.1) Length = 549 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +1 Query: 22 KYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSL 171 K + F S+ + ELDW+V ++ + I R D + + SL Sbjct: 479 KISKGNFESSMIISSQGMAELDWWVNNIDNSFNDINRPPIDITIYSDASL 528 >SB_11039| Best HMM Match : Lig_chan (HMM E-Value=1.2) Length = 116 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 370 NKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNIPHYTP 510 N F + DRP+L +QP K ++ G + Y F +P +P Sbjct: 24 NSNFAFISDRPILEYIARQPEYCGKLKVIGGFGSTYGYGFALPLNSP 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,585,028 Number of Sequences: 59808 Number of extensions: 387573 Number of successful extensions: 1009 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1007 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -