BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31373 (704 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 26 1.0 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 25 1.8 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 25 2.3 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 24 4.1 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 24 4.1 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 7.1 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 26.2 bits (55), Expect = 1.0 Identities = 14/67 (20%), Positives = 32/67 (47%) Frame = +2 Query: 110 FRRLSSVSSTPGTPTLY*TPQAIRTV*HGTSISGSARGPARTKPARRPSSR*TWTTNNSR 289 +R+L TP Y + + ++ G++++ +A G + + P PS+ + T + Sbjct: 125 YRKLYRGEKTPERYAPYLAVRPVESLTSGSNVAAAAAGASASTPPTIPSASPSPTRSTDL 184 Query: 290 DQRYSTE 310 Q Y+ + Sbjct: 185 SQTYAID 191 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.4 bits (53), Expect = 1.8 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 268 LDDEQFQGSAVQHREVQYYESKEFLEYFSPAIRYLKG 378 +D+ G+ Q+ + +KE+L Y SP+ +L G Sbjct: 957 VDESDDNGAIKQNEFPSWASNKEYLAYNSPSATFLGG 993 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 25.0 bits (52), Expect = 2.3 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 275 TNNSRDQRYSTERSNITSPRSS*NISHQPSAI*KADTPQA 394 T + D+ S R+N T S ++S S +A+TP+A Sbjct: 259 TEDDEDENISVTRTNSTIRSRSSSLSRSRSCSRQAETPRA 298 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 24.2 bits (50), Expect = 4.1 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +1 Query: 541 FVFVGEKAKGVE--RMKAITVANQIKDQDHNGRADIEVVDSEAHDGNLRQVLRCPR 702 F GE A G+ R+K ++ + NGR +I +V S+ +D ++ C R Sbjct: 402 FEIFGEVAMGLACFRLKGTNELSEALLKRINGRGNIHLVPSKVNDVYFLRMAVCSR 457 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 24.2 bits (50), Expect = 4.1 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +1 Query: 541 FVFVGEKAKGVE--RMKAITVANQIKDQDHNGRADIEVVDSEAHDGNLRQVLRCPR 702 F GE A G+ R+K ++ + NGR +I +V S+ +D ++ C R Sbjct: 433 FEIFGEVAMGLACFRLKGTNELSEALLKRINGRGNIHLVPSKVNDVYFLRMAVCSR 488 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.4 bits (48), Expect = 7.1 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -3 Query: 168 GVQYNVGVPGVEETELSLRNGDRFEV 91 G N +PGVEE L N + EV Sbjct: 1296 GFGNNDNLPGVEEVAAELENANESEV 1321 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 756,954 Number of Sequences: 2352 Number of extensions: 15898 Number of successful extensions: 20 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -