BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31372 (719 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schiz... 27 2.0 SPBC1685.14c |||Vid27 family protein|Schizosaccharomyces pombe|c... 27 2.0 SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schiz... 26 6.2 >SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 507 Score = 27.5 bits (58), Expect = 2.0 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = +2 Query: 161 FYCPSYSAQCNTNKYFLDSWIGNQTKNEHFSSFFLKFNIPLLKLMKVI 304 F C +A + +W N T NE + F +PL +M ++ Sbjct: 384 FACFLMTAGAAASSVLTSTWYNNNTPNESRRAVFTSVGVPLANVMGLV 431 >SPBC1685.14c |||Vid27 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 801 Score = 27.5 bits (58), Expect = 2.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +3 Query: 600 ALGNFVWGNVHSTNIYRI 653 +LG ++WGN +ST I +I Sbjct: 6 SLGKYIWGNTNSTEIVQI 23 >SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 674 Score = 25.8 bits (54), Expect = 6.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 448 WLRIVYKWCNFCLRDD 495 W R VY W N+CL ++ Sbjct: 358 WRRYVYIWLNYCLFEE 373 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,142,776 Number of Sequences: 5004 Number of extensions: 68963 Number of successful extensions: 149 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -