BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31372 (719 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 23 7.2 AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal prot... 23 9.5 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 Query: 601 LWVISFGVMSIPLTFTAYAPQLILTYDILYN 693 LW + G+M IP FT + + D+ N Sbjct: 131 LWFVDTGMMEIPGNFTVVQRPSVWSIDLNTN 161 >AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal protein rpL7a protein. Length = 271 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 589 IYRKMCTFAAISTFTVTYACHRYRVVPQIKYN 494 +YRK CT A++ F + ++V IK N Sbjct: 200 VYRKTCTCVALTQFENADKPNLAKLVETIKTN 231 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 783,027 Number of Sequences: 2352 Number of extensions: 17253 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -