BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31368 (568 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 27 0.11 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 1.8 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 2.4 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 5.6 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 7.3 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 9.7 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 27.1 bits (57), Expect = 0.11 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +1 Query: 427 CATNKQNSSACPTNSTRPANRKTPSPAKTRKWVMTCMMLARTSP 558 C+T +NS P + AN K P + + T RTSP Sbjct: 434 CSTPTENSPTKPYYKLKTANNKRPPSTELGTNIYTSSKRQRTSP 477 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.0 bits (47), Expect = 1.8 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 540 HHASHHPFSCFRGRGRL 490 HH + H +CF RG L Sbjct: 367 HHLARHAVACFLTRGDL 383 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.6 bits (46), Expect = 2.4 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = +2 Query: 23 FGIRSRPTGRGVRSSS---GPRTSA 88 FG R R TGRG++ S GP++ + Sbjct: 8 FGKRGRSTGRGLKYSGQQHGPQSDS 32 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 5.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -2 Query: 537 HASHHPFSCFRGRGRLSVR 481 H + PF C + RGR R Sbjct: 241 HTNEKPFECDKCRGRFRRR 259 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.0 bits (42), Expect = 7.3 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 412 KPSATCATNKQNSSAC 459 K + C NK+N +AC Sbjct: 43 KNNGECVINKKNRTAC 58 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 20.6 bits (41), Expect = 9.7 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = +2 Query: 431 QQTNRTPARVPR-TRQDPRTE-RRPRP 505 ++TN P PR T R E +RPRP Sbjct: 308 EKTNIAPRERPRATDHQRRNEPKRPRP 334 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,112 Number of Sequences: 336 Number of extensions: 1869 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13995094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -