BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31368 (568 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 28 0.057 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 2.1 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 2.1 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 2.1 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 3.7 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 6.5 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 28.3 bits (60), Expect = 0.057 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 Query: 222 SRFAPPVPGCGWSTCDGFPRFXXXXXXXXXQTW 124 +R PPVPG ++TCD R TW Sbjct: 1650 NRKLPPVPGSNYNTCDRIKRGTVIRSIRSHSTW 1682 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.0 bits (47), Expect = 2.1 Identities = 8/20 (40%), Positives = 16/20 (80%) Frame = +3 Query: 345 EQLERVNIEIKSRLEETVQL 404 + L+R NI++ +R E+T+Q+ Sbjct: 332 QSLDRQNIDVVARNEDTLQM 351 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.0 bits (47), Expect = 2.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 540 HHASHHPFSCFRGRGRL 490 HH + H +CF RG L Sbjct: 371 HHLARHAVACFLTRGDL 387 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.0 bits (47), Expect = 2.1 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 478 PANRKTPSPAKTRK 519 P+NRK P+PA +K Sbjct: 387 PSNRKLPAPANWKK 400 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 509 FAGEGVFLFAGLVEF 465 F G +FLFA +VEF Sbjct: 298 FLGCTIFLFAAMVEF 312 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/33 (21%), Positives = 18/33 (54%) Frame = +2 Query: 176 SQVLHPHPGTGGANRDPHRENQQR*KTEVSSAE 274 +++ PH ++ P+R + + +T++ S E Sbjct: 375 ARIFSPHEENESVDKHPNRRARGQLRTKIESGE 407 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,532 Number of Sequences: 438 Number of extensions: 2665 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -