BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31365 (614 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 140 7e-36 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.4 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.4 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 22 4.1 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 5.5 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 7.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 9.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.6 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 140 bits (340), Expect = 7e-36 Identities = 64/68 (94%), Positives = 67/68 (98%) Frame = +2 Query: 410 EMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKC 589 EMATAA+S+SLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHET YNSIMKC Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 590 DVDIRKDL 613 DVDIRKDL Sbjct: 61 DVDIRKDL 68 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 14 LRVAPEEHPVLLTEAPLNPKANREKM 91 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.4 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -2 Query: 376 LLDVTNDFPLSGGGERVTPLGEDLHEVVGQVATSQVQTEDGVGQS-VTFVDGYGVGDT 206 ++D+T S G+ V +L+ +VG A + E+G G + VT + + DT Sbjct: 18 MVDLTQCLQESSTGQSVEFSPMELNALVGTPAAPNMPAEEGEGMAGVTGEEPFDTLDT 75 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 22.2 bits (45), Expect = 4.1 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -3 Query: 603 RMSTSHFMMELYT--VSWMPHDSIPRKEGWKR 514 R F+ L T W+ +++I RK W R Sbjct: 18 RSENDPFLKRLITGDEKWVVYNNIKRKRSWSR 49 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -3 Query: 603 RMSTSHFMMELYT--VSWMPHDSIPRKEGWKR 514 R F+ L T W+ +++I RK W R Sbjct: 139 RNENDPFLKRLITGDEKWVVYNNIKRKRSWSR 170 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = -3 Query: 189 TIPVVRPEAYSESTAWMATYMAGELKVSNMIWVIFSL 79 T+P + E + AWM G L+ N + F + Sbjct: 33 TLPGYKIECVGDDIAWMKFDKEGRLRAINPEYGFFGV 69 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +2 Query: 212 SHTVPIYEGYALPHAILRLDLAGRDLTDYLMKI 310 +H + Y GY P + D A + T+ MK+ Sbjct: 187 NHQLISYAGYKNPDGTIIGDPANIEFTELCMKL 219 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -2 Query: 586 LHDGVVHGLVDAARFHTQEG 527 +H G +H V ++ TQ+G Sbjct: 907 VHQGQIHLTVAVVQYKTQDG 926 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 208 CLPHRTHLRRLRSAPRHPPS 267 C P +L ++ S P HPP+ Sbjct: 79 CDPVPGNLEQIGSRPLHPPA 98 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,148 Number of Sequences: 438 Number of extensions: 2678 Number of successful extensions: 16 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -