BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31364 (799 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) 44 1e-04 SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) 44 2e-04 SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 44 2e-04 SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 44 2e-04 SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) 42 8e-04 SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) 42 8e-04 SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) 41 0.001 SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 39 0.004 SB_19678| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_3533| Best HMM Match : Pentapeptide (HMM E-Value=5.7) 31 0.82 SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_14478| Best HMM Match : DUF1168 (HMM E-Value=3) 31 1.1 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_15952| Best HMM Match : TPR_1 (HMM E-Value=5.8e-11) 29 5.8 SB_20600| Best HMM Match : zf-C3HC4 (HMM E-Value=0.65) 28 7.6 SB_16838| Best HMM Match : TolA (HMM E-Value=2) 28 7.6 >SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) Length = 189 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +1 Query: 391 TLKL-RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAI 567 TL++ + DV +Y PEEI K + + V +H + + +E+ R F LP+G +PE + Sbjct: 6 TLEIAKLDVKEYRPEEISFKVENGVVKVQGRHVNEGEFGFELKEFRRTFTLPEGIDPENV 65 Query: 568 KS 573 S Sbjct: 66 TS 67 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/56 (32%), Positives = 35/56 (62%) Frame = +1 Query: 400 LRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAI 567 + DV+ + PE I V+ + N+LLV+A HE + + +NR+F+LP+ + +++ Sbjct: 100 MAIDVAGFPPESIKVQVLGNELLVNANHEVEHEGHYHAMHFNRQFVLPREVDMDSL 155 >SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) Length = 424 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/66 (30%), Positives = 39/66 (59%) Frame = +1 Query: 370 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 549 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + +NR+F+LP+ Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 150 Query: 550 TNPEAI 567 + +++ Sbjct: 151 VDMDSL 156 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/66 (30%), Positives = 39/66 (59%) Frame = +1 Query: 370 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 549 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + +NR+F+LP+ Sbjct: 326 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 384 Query: 550 TNPEAI 567 + +++ Sbjct: 385 VDMDSL 390 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 403 RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKS 573 + DV +Y PEEI K + + V +H + +E+ R F LP+G +K+ Sbjct: 11 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFTLPEGVEASNVKT 67 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 403 RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKS 573 + DV +Y PEEI K + + V +H + +E+ R F LP+G +K+ Sbjct: 245 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFTLPEGVEASNVKT 301 >SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/66 (30%), Positives = 39/66 (59%) Frame = +1 Query: 370 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 549 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + +NR+F+LP+ Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 150 Query: 550 TNPEAI 567 + +++ Sbjct: 151 VDMDSL 156 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 403 RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKS 573 + DV +Y PEEI K + + V +H + +E+ R F LP+G +K+ Sbjct: 11 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFTLPEGVEASNVKT 67 >SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/66 (30%), Positives = 39/66 (59%) Frame = +1 Query: 370 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 549 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + +NR+F+LP+ Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 150 Query: 550 TNPEAI 567 + +++ Sbjct: 151 VDMDSL 156 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 403 RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKS 573 + DV +Y PEEI K + + V +H + +E+ R F LP+G +K+ Sbjct: 11 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFALPEGVEASNVKT 67 >SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/66 (30%), Positives = 39/66 (59%) Frame = +1 Query: 370 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 549 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + +NR+F+LP+ Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 150 Query: 550 TNPEAI 567 + +++ Sbjct: 151 VDMDSL 156 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 403 RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKS 573 + DV +Y PEEI K + + V +H + +E+ R F LP+G +K+ Sbjct: 11 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFALPEGVEASNVKT 67 >SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) Length = 695 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/64 (29%), Positives = 34/64 (53%) Frame = +1 Query: 376 EGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTN 555 E + DV + PE I V+ + N+LLV A HE + + +NR+F+LP+ + Sbjct: 93 ESKDDKFSMAMDVKGFPPEAIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFILPREVD 152 Query: 556 PEAI 567 +++ Sbjct: 153 MDSL 156 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 403 RFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKS 573 + DV +Y PEEI K + + V +H + +E+ R F LP+G +K+ Sbjct: 12 KLDVREYRPEEISFKVENGVVKVQGRHVNEGPFGFELKEFRRTFTLPEGVEASNVKT 68 >SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) Length = 185 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/62 (32%), Positives = 33/62 (53%) Frame = +1 Query: 382 DGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPE 561 D L DVS + PEE+ VK ++L V A+ E + R++NR F+LP+ + + Sbjct: 96 DDTKFTLALDVSDFKPEEVDVKVYGHELSVRARQECEEHGFFTARQFNRHFVLPREVDMD 155 Query: 562 AI 567 + Sbjct: 156 TL 157 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +1 Query: 409 DVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKS 573 DV ++ PEEI K + K+ V +S+ +E+ R + LP+G + +I + Sbjct: 12 DVREFKPEEITCKVENGKIKVSGLQRHESEEGFDSKEFRRCYNLPEGVDESSIST 66 >SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) Length = 259 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +1 Query: 382 DGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPK 546 D L DVS + PEE+ VK ++L V A+ E + R++NR F+LP+ Sbjct: 24 DDTKFTLALDVSDFKPEEVDVKVYGHELSVRARQECEEHGFFTARQFNRHFVLPQ 78 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = +1 Query: 376 EGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTN 555 EGD K DV Y PEEI +K ++ + KH+ + + E++R + LP G + Sbjct: 36 EGD-KVEIATLDVKNYRPEEISLKVEHGRIKIDGKHKSEGEHGYETSEFHRSYNLPDGVD 94 Query: 556 PEAIKS 573 + S Sbjct: 95 VSTVSS 100 >SB_19678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 33.1 bits (72), Expect = 0.27 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Frame = +1 Query: 382 DGKTLKLRFDVSQYTPEEIVVKTVDNKLLV---HAKHEEKSDTKSVYREYNREFLLPKGT 552 + T ++ D + P + ++ NK +V +A+ + K D S YR R LP+G Sbjct: 702 ENATHSVQSDTYSHIPGDDTFESCRNKFVVKEVYAESDTKPDVISDYRRGQRRRTLPRGC 761 Query: 553 NPE 561 NPE Sbjct: 762 NPE 764 >SB_3533| Best HMM Match : Pentapeptide (HMM E-Value=5.7) Length = 416 Score = 31.5 bits (68), Expect = 0.82 Identities = 20/90 (22%), Positives = 44/90 (48%) Frame = +1 Query: 310 SDSRQLAEPSHWDSLNSPLIQDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEE 489 ++ RQLAE +H++ ++ L Q++G + ++F Y+ + T++++ V+ + Sbjct: 45 AEPRQLAE-AHFNHVSWQLNQEDGQLEIADVKFMDFSYSKTTLTDATIEHRFEVNRCNMR 103 Query: 490 KSDTKSVYREYNREFLLPKGTNPEAIKSFA 579 S+Y+ Y KGT + F+ Sbjct: 104 NLLPNSIYKVYKSYQKRTKGTTQGRTQDFS 133 >SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 31.5 bits (68), Expect = 0.82 Identities = 20/57 (35%), Positives = 31/57 (54%) Frame = +1 Query: 157 IDTEFSSIRERFDAEMRKMEEEMSKFRSELMNRESNNFFKXXXXXXXXXQHSDSRQL 327 ++ E SS+RE DA RKM ++SK +L +E+N + QHSD+ +L Sbjct: 255 LEKEISSLREIVDARERKM-VQLSKDNIDL--QETNAILRSQLEQLESMQHSDNAEL 308 >SB_14478| Best HMM Match : DUF1168 (HMM E-Value=3) Length = 376 Score = 31.1 bits (67), Expect = 1.1 Identities = 24/82 (29%), Positives = 35/82 (42%) Frame = +1 Query: 451 VDNKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKSFAVPGTVCLPWKRHCHNSP 630 VD +H +HE S T++ + ++L P P F G V P ++ SP Sbjct: 291 VDKPDEMHPEHETISATETESKPQLPDWLEPVKDEPHKPVDFT-EGDVSEPEEKEKKTSP 349 Query: 631 SRTGTFLSRSTGAVSSFATSPL 696 +TG +S A S T PL Sbjct: 350 KQTGVPVSEDVVASSRDRTEPL 371 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 29.5 bits (63), Expect = 3.3 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +3 Query: 111 WSQEKYPHQAWRFFGYRY-RILKHQRALRCRNEEDGRRNEQIQI-RTHEQRKQQFLQE 278 W Q+ PH GYRY + +KH + R R + Q+QI R E+RKQ L + Sbjct: 127 WQQKYGPHYKKLDLGYRYLKRIKHVSFDQIRE----RASAQLQIERERERRKQDLLMK 180 >SB_15952| Best HMM Match : TPR_1 (HMM E-Value=5.8e-11) Length = 672 Score = 28.7 bits (61), Expect = 5.8 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +1 Query: 112 GLKRNIPIKLGDFSVIDTEFSSIRERFDAEMRKMEEEMSKFRSELMNRES 261 G K+N K S D+ S++ FD+E K+ E FR++ NR+S Sbjct: 52 GKKKNGAAKGKIVSKSDSLRSALSFDFDSETEKIRREYEVFRAQQANRDS 101 >SB_20600| Best HMM Match : zf-C3HC4 (HMM E-Value=0.65) Length = 963 Score = 28.3 bits (60), Expect = 7.6 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 4/97 (4%) Frame = -3 Query: 704 CCLSGLVANDETAPVLLDRNVPVRDGELWQWRFHGKHTVPGTAKDLMA----SGFVPLGN 537 CC S + D + L +N +D L H VPGT + SGF+ + Sbjct: 161 CCSSSRIETDSVS--LSSQNGSPKDASLLMATSHPM-AVPGTPAIPIEPEEDSGFMASID 217 Query: 536 KNSLLYSLYTDFVSDFSSCLAWTSNLLSTVLTTISSG 426 NS S+ + + S C ++ L + +T+I SG Sbjct: 218 SNSFAGSMTSLYTPSSSPCGSFQRRLYRSQVTSIDSG 254 >SB_16838| Best HMM Match : TolA (HMM E-Value=2) Length = 371 Score = 28.3 bits (60), Expect = 7.6 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +3 Query: 84 ANNVKNG*QWSQEKYPHQAWRFFGYRYRIL-KHQRALRCRNEEDGRRNEQIQIRTHEQRK 260 + N N Q Q+K Q R + Y + K Q+ + R ++ +R +Q Q +QR+ Sbjct: 28 SRNNSNNVQLQQQKRQQQQKRTYNYDIQQQQKRQQQQQKRQQQKQKRQQQEQKLQQQQRR 87 Query: 261 QQ 266 QQ Sbjct: 88 QQ 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,950,065 Number of Sequences: 59808 Number of extensions: 484469 Number of successful extensions: 1621 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1619 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -