BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31361 (491 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 3.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 3.1 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 4.1 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 5.4 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 3.1 Identities = 8/34 (23%), Positives = 15/34 (44%) Frame = +3 Query: 120 IPYAAFLKKVMA*KTSQLVISLVIRSFPATNVRW 221 +PY + KV A L + + +P ++W Sbjct: 519 LPYIRLIPKVTAVAGETLRLKCPVAGYPIEEIKW 552 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 3.1 Identities = 8/34 (23%), Positives = 15/34 (44%) Frame = +3 Query: 120 IPYAAFLKKVMA*KTSQLVISLVIRSFPATNVRW 221 +PY + KV A L + + +P ++W Sbjct: 519 LPYIRLIPKVTAVAGETLRLKCPVAGYPIEEIKW 552 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 137 PEEGHGVEDITTRHIFSYKILS 202 P EG + D RHI IL+ Sbjct: 364 PSEGEDISDYKFRHITEITILT 385 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 443 KIKYTVEHSQKKKKKK 490 K K + EH KKKK K Sbjct: 202 KSKASEEHGNKKKKNK 217 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,020 Number of Sequences: 438 Number of extensions: 1994 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13544190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -