BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31358 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 25 2.1 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 23 8.4 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 25.0 bits (52), Expect = 2.1 Identities = 14/49 (28%), Positives = 17/49 (34%) Frame = -2 Query: 466 PR*DFDIEPAFFRTPAHRRYAPQTCQYHRGCGAPTARRTNATTSFLTAT 320 PR F P + R P HR +PT + TT T T Sbjct: 98 PRPPFGGRPWWLRPPFHRPTTSTAAPEGTSVASPTTAEASTTTEAATTT 146 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 23.0 bits (47), Expect = 8.4 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = -2 Query: 169 PRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 26 P A S A +P LDV+ AP P + D P VT E+ +ES Sbjct: 283 PAATSAPLAFKVP-LDVLP---APFPGPSTDEPRTVTRKRTTESDVES 326 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 694,880 Number of Sequences: 2352 Number of extensions: 14517 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -