BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31356 (665 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47415| Best HMM Match : No HMM Matches (HMM E-Value=.) 138 3e-33 SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_48435| Best HMM Match : Ion_trans (HMM E-Value=1.7e-11) 29 3.4 SB_11967| Best HMM Match : Pollen_allerg_2 (HMM E-Value=1.7) 29 3.4 SB_14633| Best HMM Match : LRR_1 (HMM E-Value=3.4e-12) 29 4.5 SB_2694| Best HMM Match : LIM (HMM E-Value=6.6e-14) 28 7.9 >SB_47415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 138 bits (335), Expect = 3e-33 Identities = 65/103 (63%), Positives = 80/103 (77%), Gaps = 3/103 (2%) Frame = +1 Query: 19 PFADAIKS---SEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKEFACN 189 PF DA K S VQ ++HVRIQQRNGRKTLTT+QG+S EYD KK+V+A KK+FACN Sbjct: 482 PFEDASKGDGESNTSVQRDVIHVRIQQRNGRKTLTTIQGISDEYDKKKLVKAFKKQFACN 541 Query: 190 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 318 GTVV+HPEYGE +QLQGDQR + ++L + L K +Q+KVHGF Sbjct: 542 GTVVDHPEYGECIQLQGDQRAHAQEFLLQIDLAKKDQIKVHGF 584 >SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/68 (30%), Positives = 31/68 (45%) Frame = -1 Query: 290 FTKPDLVSHWQIFSRWSP*SCSTSPYSGCSTTVPLHANSFLHARTIFFRSYSEERPCTVV 111 +TK +L H +I + P C PY C + N +HART +++ERP Sbjct: 583 YTKTELRQHVRIHTGEKPYKC---PY--CDKAFAVKGNCTVHART-----HTKERPYKCT 632 Query: 110 SVLRPFRC 87 + R F C Sbjct: 633 NCGRAFSC 640 >SB_48435| Best HMM Match : Ion_trans (HMM E-Value=1.7e-11) Length = 1496 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 220 EVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF*AALLKHNMSTLNI 360 +VL+ QR++ QW G+V+P QL A + M+ LN+ Sbjct: 1157 KVLEFVAIQRKDNNQWAIPGGMVEPGQLVTQALKAEFGEEAMAKLNV 1203 >SB_11967| Best HMM Match : Pollen_allerg_2 (HMM E-Value=1.7) Length = 1815 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = -3 Query: 636 IELLQQFKNTMSYKNKNKLLGIFTISFD*LFCNL*DETAAIIYKIYNILYNRG 478 +E LQ K+ S + K L + T+ F+ LFC ET A++ + +N+ + G Sbjct: 1155 LEYLQVSKDCPSTE---KALRMATLQFNSLFCIANQETLAVLAQFFNVAFPSG 1204 >SB_14633| Best HMM Match : LRR_1 (HMM E-Value=3.4e-12) Length = 446 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 554 SNEIVNIPNSLFLFLYDIVFLNCCNNSI 637 +N+I IPN LF+ L D+++L+ +N + Sbjct: 69 NNKISVIPNQLFINLIDLIYLDLSDNCL 96 >SB_2694| Best HMM Match : LIM (HMM E-Value=6.6e-14) Length = 446 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Frame = -1 Query: 203 STTVPLHA---NSFLHART--IFFRSYSEERPCTVVSVLRPFRC 87 STTV +H N+ LH R I+ R+Y+ + P +S P RC Sbjct: 254 STTVAVHKDARNADLHTRVTLIYRRAYNADLPTRTMSEGAPMRC 297 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,522,680 Number of Sequences: 59808 Number of extensions: 421385 Number of successful extensions: 2450 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2450 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -