BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31355 (669 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5KCR5 Cluster: Variable surface protein Vir5-related; ... 33 8.2 >UniRef50_A5KCR5 Cluster: Variable surface protein Vir5-related; n=1; Plasmodium vivax|Rep: Variable surface protein Vir5-related - Plasmodium vivax Length = 528 Score = 32.7 bits (71), Expect = 8.2 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 4/82 (4%) Frame = +2 Query: 95 HIENYISNLRYTSIKVQNV*FKKKYITKIQLSIFLTGSYLNLFLVMVII*--KEVQNNRQ 268 H+E +++ SIK+ +TKI SY+N + +I+ + NN + Sbjct: 274 HLEKKYKDIKIVSIKLAANLDSLSSMTKISADHSERCSYMNYWTYNIIMHTLSSISNNDE 333 Query: 269 --YYLRV*NTYLFDVTNLCTKE 328 Y L++ N LFD+ + TKE Sbjct: 334 KIYLLKIINNLLFDINDKLTKE 355 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 550,424,134 Number of Sequences: 1657284 Number of extensions: 9541686 Number of successful extensions: 18433 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 18006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18432 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51239674196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -