BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31355 (669 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10770.1 68414.m01233 invertase/pectin methylesterase inhibit... 28 4.9 At5g58100.1 68418.m07270 expressed protein 27 8.5 >At1g10770.1 68414.m01233 invertase/pectin methylesterase inhibitor family protein contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 167 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 548 ALDNLCRTFVQPVTRERESTHETDYPLHLWTRIS 447 A +LCR V+ VT R++TH T L T+++ Sbjct: 42 AYPSLCRPLVKRVTSPRKATHRTIQALEAKTKLA 75 >At5g58100.1 68418.m07270 expressed protein Length = 945 Score = 27.5 bits (58), Expect = 8.5 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = -2 Query: 620 SYFMTRCDESLR--NDGIFYGLLVTYALDNLCRTFVQPVTRERESTHETDYPLHLWTRIS 447 SY +T +ES++ N GI L+ N +TF +RERE ++ Y + LW R+S Sbjct: 810 SYMITALEESIQAVNSGIH---LLRLERTNK-KTFKLFQSRERELMNKYKYVVSLWRRLS 865 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,050,465 Number of Sequences: 28952 Number of extensions: 211915 Number of successful extensions: 346 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 346 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -