BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31353 (608 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y00472-1|CAA68533.1| 222|Homo sapiens protein ( Human mRNA for ... 159 5e-39 X07834-1|CAA30687.1| 222|Homo sapiens protein ( Human mRNA for ... 159 7e-39 Y00985-1|CAA68791.1| 222|Homo sapiens protein ( Human mRNA for ... 158 1e-38 X59445-1|CAA42066.1| 222|Homo sapiens manganese superoxide dism... 158 1e-38 X15132-1|CAA33228.1| 222|Homo sapiens protein ( Human mRNA for ... 158 1e-38 X14322-1|CAA32502.1| 222|Homo sapiens Manganese superoxide dism... 158 1e-38 M36693-1|AAA36622.1| 222|Homo sapiens protein ( Human manganese... 158 1e-38 BT006967-1|AAP35613.1| 222|Homo sapiens superoxide dismutase 2,... 158 1e-38 BC012423-1|AAH12423.1| 222|Homo sapiens superoxide dismutase 2,... 158 1e-38 AY280721-1|AAP34410.1| 213|Homo sapiens manganese-containing su... 158 1e-38 AY267901-1|AAP03428.1| 222|Homo sapiens superoxide dismutase 2,... 158 1e-38 AL135914-1|CAI21845.1| 222|Homo sapiens superoxide dismutase 2,... 158 1e-38 AY280719-1|AAP34408.1| 210|Homo sapiens manganese-containing su... 153 6e-37 AY280718-1|AAP34407.1| 213|Homo sapiens manganese-containing su... 153 6e-37 DQ003134-1|AAY21807.1| 212|Homo sapiens manganese-containing su... 152 8e-37 AY280720-1|AAP34409.1| 209|Homo sapiens manganese-containing su... 152 8e-37 U02619-1|AAA17985.1| 2109|Homo sapiens TFIIIC Box B-binding subu... 31 3.2 DQ205142-1|ABB54402.1| 126|Homo sapiens immunoglobulin heavy ch... 31 3.2 BC044857-1|AAH44857.1| 978|Homo sapiens GTF3C1 protein protein. 31 3.2 AK131479-1|BAD18624.1| 279|Homo sapiens Da (GTF3C1). protein. 31 3.2 AC002303-1|AAB67637.1| 1857|Homo sapiens Transcription factor (T... 31 3.2 Y15635-1|CAA75729.1| 2273|Homo sapiens ABCR protein. 29 9.7 U88667-1|AAC51144.1| 2273|Homo sapiens ATP-binding cassette tran... 29 9.7 AF001945-1|AAC05632.1| 2273|Homo sapiens rim ABC transporter pro... 29 9.7 AF000148-1|AAC23915.1| 2273|Homo sapiens ATP-binding cassette tr... 29 9.7 AB210040-1|BAE06122.1| 2303|Homo sapiens ABCA4 variant protein p... 29 9.7 >Y00472-1|CAA68533.1| 222|Homo sapiens protein ( Human mRNA for Mn superoxide dismutase (EC 1.15.1.1.). ). Length = 222 Score = 159 bits (387), Expect = 5e-39 Identities = 67/94 (71%), Positives = 79/94 (84%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NKQ LQIA C NQDPLQ TTGL+PL GID Sbjct: 124 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKQRGHLQIAACPNQDPLQGTTGLIPLLGID 183 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 438 VWEHAYYLQYKNVR DY+KAI++V NW ++++RY Sbjct: 184 VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY 217 >X07834-1|CAA30687.1| 222|Homo sapiens protein ( Human mRNA for manganese superoxide dismutase (EC 1.15.1.1). ). Length = 222 Score = 159 bits (386), Expect = 7e-39 Identities = 66/95 (69%), Positives = 80/95 (84%) Frame = +1 Query: 154 IDFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGI 333 +DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GI Sbjct: 123 LDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGI 182 Query: 334 DVWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 438 DVWEHAYYLQYKNVR DY+KAI++V NW ++++RY Sbjct: 183 DVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY 217 >Y00985-1|CAA68791.1| 222|Homo sapiens protein ( Human mRNA for manganese-containing superoxide dismutase. ). Length = 222 Score = 158 bits (384), Expect = 1e-38 Identities = 66/94 (70%), Positives = 79/94 (84%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 124 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 183 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 438 VWEHAYYLQYKNVR DY+KAI++V NW ++++RY Sbjct: 184 VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY 217 >X59445-1|CAA42066.1| 222|Homo sapiens manganese superoxide dismutase (MnSOD) protein. Length = 222 Score = 158 bits (384), Expect = 1e-38 Identities = 66/94 (70%), Positives = 79/94 (84%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 124 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 183 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 438 VWEHAYYLQYKNVR DY+KAI++V NW ++++RY Sbjct: 184 VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY 217 >X15132-1|CAA33228.1| 222|Homo sapiens protein ( Human mRNA for manganese containing superoxide dismutase (EC 1.15.1.1). ). Length = 222 Score = 158 bits (384), Expect = 1e-38 Identities = 66/94 (70%), Positives = 79/94 (84%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 124 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 183 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 438 VWEHAYYLQYKNVR DY+KAI++V NW ++++RY Sbjct: 184 VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY 217 >X14322-1|CAA32502.1| 222|Homo sapiens Manganese superoxide dismutase protein. Length = 222 Score = 158 bits (384), Expect = 1e-38 Identities = 66/94 (70%), Positives = 79/94 (84%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 124 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 183 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 438 VWEHAYYLQYKNVR DY+KAI++V NW ++++RY Sbjct: 184 VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY 217 >M36693-1|AAA36622.1| 222|Homo sapiens protein ( Human manganese-containing superoxide dismutase mRNA, complete cds. ). Length = 222 Score = 158 bits (384), Expect = 1e-38 Identities = 66/94 (70%), Positives = 79/94 (84%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 124 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 183 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 438 VWEHAYYLQYKNVR DY+KAI++V NW ++++RY Sbjct: 184 VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY 217 >BT006967-1|AAP35613.1| 222|Homo sapiens superoxide dismutase 2, mitochondrial protein. Length = 222 Score = 158 bits (384), Expect = 1e-38 Identities = 66/94 (70%), Positives = 79/94 (84%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 124 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 183 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 438 VWEHAYYLQYKNVR DY+KAI++V NW ++++RY Sbjct: 184 VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY 217 >BC012423-1|AAH12423.1| 222|Homo sapiens superoxide dismutase 2, mitochondrial protein. Length = 222 Score = 158 bits (384), Expect = 1e-38 Identities = 66/94 (70%), Positives = 79/94 (84%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 124 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 183 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 438 VWEHAYYLQYKNVR DY+KAI++V NW ++++RY Sbjct: 184 VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY 217 >AY280721-1|AAP34410.1| 213|Homo sapiens manganese-containing superoxide dismutase protein. Length = 213 Score = 158 bits (384), Expect = 1e-38 Identities = 66/94 (70%), Positives = 79/94 (84%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 120 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 179 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 438 VWEHAYYLQYKNVR DY+KAI++V NW ++++RY Sbjct: 180 VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY 213 >AY267901-1|AAP03428.1| 222|Homo sapiens superoxide dismutase 2, mitochondrial protein. Length = 222 Score = 158 bits (384), Expect = 1e-38 Identities = 66/94 (70%), Positives = 79/94 (84%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 124 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 183 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 438 VWEHAYYLQYKNVR DY+KAI++V NW ++++RY Sbjct: 184 VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY 217 >AL135914-1|CAI21845.1| 222|Homo sapiens superoxide dismutase 2, mitochondrial protein. Length = 222 Score = 158 bits (384), Expect = 1e-38 Identities = 66/94 (70%), Positives = 79/94 (84%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 124 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 183 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDISQRY 438 VWEHAYYLQYKNVR DY+KAI++V NW ++++RY Sbjct: 184 VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY 217 >AY280719-1|AAP34408.1| 210|Homo sapiens manganese-containing superoxide dismutase protein. Length = 210 Score = 153 bits (370), Expect = 6e-37 Identities = 64/91 (70%), Positives = 76/91 (83%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 120 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 179 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDIS 429 VWEHAYYLQYKNVR DY+KAI++V NW +++ Sbjct: 180 VWEHAYYLQYKNVRPDYLKAIWNVINWENVT 210 >AY280718-1|AAP34407.1| 213|Homo sapiens manganese-containing superoxide dismutase protein. Length = 213 Score = 153 bits (370), Expect = 6e-37 Identities = 64/91 (70%), Positives = 76/91 (83%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 123 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 182 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDIS 429 VWEHAYYLQYKNVR DY+KAI++V NW +++ Sbjct: 183 VWEHAYYLQYKNVRPDYLKAIWNVINWENVT 213 >DQ003134-1|AAY21807.1| 212|Homo sapiens manganese-containing superoxide dismutase protein. Length = 212 Score = 152 bits (369), Expect = 8e-37 Identities = 64/90 (71%), Positives = 75/90 (83%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 123 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 182 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDI 426 VWEHAYYLQYKNVR DY+KAI++V NW ++ Sbjct: 183 VWEHAYYLQYKNVRPDYLKAIWNVINWENV 212 >AY280720-1|AAP34409.1| 209|Homo sapiens manganese-containing superoxide dismutase protein. Length = 209 Score = 152 bits (369), Expect = 8e-37 Identities = 64/90 (71%), Positives = 75/90 (83%) Frame = +1 Query: 157 DFGSWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGID 336 DFGS+D K +L+ ASV VQGSGWGWLG+NK+ LQIA C NQDPLQ TTGL+PL GID Sbjct: 120 DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGID 179 Query: 337 VWEHAYYLQYKNVRADYVKAIFDVANWNDI 426 VWEHAYYLQYKNVR DY+KAI++V NW ++ Sbjct: 180 VWEHAYYLQYKNVRPDYLKAIWNVINWENV 209 >U02619-1|AAA17985.1| 2109|Homo sapiens TFIIIC Box B-binding subunit protein. Length = 2109 Score = 31.1 bits (67), Expect = 3.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 193 STASVAVQGSGWGWLGYNKQMKKLQIATCQNQDP 294 +TA + GS W WL ++ ++K + A Q +DP Sbjct: 1799 NTARLVAMGSAWPWLLHSVRLKDREDADIQREDP 1832 >DQ205142-1|ABB54402.1| 126|Homo sapiens immunoglobulin heavy chain variable region VH protein. Length = 126 Score = 31.1 bits (67), Expect = 3.2 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 1/79 (1%) Frame = -2 Query: 322 AGPIQW-WPAEDPGSGM*LFAISSFVCCSQANPSLSPVLPQKLSTVDSLSYPRIQSLSMI 146 +G W W + PG G+ ++ + NPSL + + T + R++S++ Sbjct: 31 SGDYYWSWIRQPPGKGLEWIGYIYYIGSTYYNPSLKSRVTISVDTSKNQLSLRLRSVTAA 90 Query: 145 QSFVTLT*CLKKFNKKETG 89 + V KKFN + TG Sbjct: 91 DTAVYYCARFKKFNYERTG 109 >BC044857-1|AAH44857.1| 978|Homo sapiens GTF3C1 protein protein. Length = 978 Score = 31.1 bits (67), Expect = 3.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 193 STASVAVQGSGWGWLGYNKQMKKLQIATCQNQDP 294 +TA + GS W WL ++ ++K + A Q +DP Sbjct: 693 NTARLVAMGSAWPWLLHSVRLKDREDADIQREDP 726 >AK131479-1|BAD18624.1| 279|Homo sapiens Da (GTF3C1). protein. Length = 279 Score = 31.1 bits (67), Expect = 3.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 193 STASVAVQGSGWGWLGYNKQMKKLQIATCQNQDP 294 +TA + GS W WL ++ ++K + A Q +DP Sbjct: 100 NTARLVAMGSAWPWLLHSVRLKDREDADIQREDP 133 >AC002303-1|AAB67637.1| 1857|Homo sapiens Transcription factor (TFIIIC) alpha chain, partial protein. Length = 1857 Score = 31.1 bits (67), Expect = 3.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 193 STASVAVQGSGWGWLGYNKQMKKLQIATCQNQDP 294 +TA + GS W WL ++ ++K + A Q +DP Sbjct: 1547 NTARLVAMGSAWPWLLHSVRLKDREDADIQREDP 1580 >Y15635-1|CAA75729.1| 2273|Homo sapiens ABCR protein. Length = 2273 Score = 29.5 bits (63), Expect = 9.7 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -3 Query: 330 SEERDQSSGGLQRILVLACSYLQFLHLFVVAKPTPA*ALYCHRSCRQLIL 181 +EE SGG+QR L +A +++ + ++ +PT Y RS L+L Sbjct: 1056 NEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLL 1105 >U88667-1|AAC51144.1| 2273|Homo sapiens ATP-binding cassette transporter protein. Length = 2273 Score = 29.5 bits (63), Expect = 9.7 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -3 Query: 330 SEERDQSSGGLQRILVLACSYLQFLHLFVVAKPTPA*ALYCHRSCRQLIL 181 +EE SGG+QR L +A +++ + ++ +PT Y RS L+L Sbjct: 1056 NEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLL 1105 >AF001945-1|AAC05632.1| 2273|Homo sapiens rim ABC transporter protein. Length = 2273 Score = 29.5 bits (63), Expect = 9.7 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -3 Query: 330 SEERDQSSGGLQRILVLACSYLQFLHLFVVAKPTPA*ALYCHRSCRQLIL 181 +EE SGG+QR L +A +++ + ++ +PT Y RS L+L Sbjct: 1056 NEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLL 1105 >AF000148-1|AAC23915.1| 2273|Homo sapiens ATP-binding cassette transporter protein. Length = 2273 Score = 29.5 bits (63), Expect = 9.7 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -3 Query: 330 SEERDQSSGGLQRILVLACSYLQFLHLFVVAKPTPA*ALYCHRSCRQLIL 181 +EE SGG+QR L +A +++ + ++ +PT Y RS L+L Sbjct: 1056 NEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLL 1105 >AB210040-1|BAE06122.1| 2303|Homo sapiens ABCA4 variant protein protein. Length = 2303 Score = 29.5 bits (63), Expect = 9.7 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -3 Query: 330 SEERDQSSGGLQRILVLACSYLQFLHLFVVAKPTPA*ALYCHRSCRQLIL 181 +EE SGG+QR L +A +++ + ++ +PT Y RS L+L Sbjct: 1086 NEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLL 1135 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,910,913 Number of Sequences: 237096 Number of extensions: 1914175 Number of successful extensions: 3395 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 3290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3395 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6466646650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -