BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31346 (763 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0672 + 30775458-30775523,30775594-30775662,30775748-307757... 29 5.3 >02_05_0672 + 30775458-30775523,30775594-30775662,30775748-30775797, 30775869-30775929,30776016-30776381,30776542-30776754, 30776826-30777056,30777502-30777615,30777703-30778495, 30778535-30778905,30779007-30779378,30779448-30780438, 30781068-30781141,30781953-30782030,30782448-30782525 Length = 1308 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 281 YKNVDIFILLIMKYKKVIRCPEYDCSLLIFFASIG 385 YK V +F L + + P++DCS +IF +S G Sbjct: 1228 YKKVKVFSLAVADTDGSNQLPQHDCSTVIFRSSEG 1262 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,203,683 Number of Sequences: 37544 Number of extensions: 355670 Number of successful extensions: 559 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2039640244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -