BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31341 (511 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15520.1 68418.m01817 40S ribosomal protein S19 (RPS19B) 40S ... 158 2e-39 At3g02080.1 68416.m00173 40S ribosomal protein S19 (RPS19A) simi... 157 4e-39 At5g61170.1 68418.m07674 40S ribosomal protein S19 (RPS19C) 40S ... 155 1e-38 At4g16095.1 68417.m02440 disease resistance protein-related cont... 29 1.4 At5g45800.1 68418.m05632 leucine-rich repeat transmembrane prote... 29 1.8 At1g14300.1 68414.m01695 expressed protein contains Pfam PF04063... 29 2.4 At5g16500.1 68418.m01928 protein kinase family protein contains ... 27 7.3 At3g24000.1 68416.m03014 pentatricopeptide (PPR) repeat-containi... 27 7.3 At2g02480.1 68415.m00187 DNA polymerase-related weak similarity ... 27 7.3 At4g37360.1 68417.m05291 cytochrome P450 family protein cytochro... 27 9.7 At1g43620.2 68414.m05008 UDP-glucose:sterol glucosyltransferase,... 27 9.7 At1g43620.1 68414.m05007 UDP-glucose:sterol glucosyltransferase,... 27 9.7 >At5g15520.1 68418.m01817 40S ribosomal protein S19 (RPS19B) 40S RIBOSOMAL PROTEIN S19 - Oryza sativa, SWISSPROT:RS19_ORYSA Length = 143 Score = 158 bits (383), Expect = 2e-39 Identities = 70/130 (53%), Positives = 93/130 (71%) Frame = +2 Query: 17 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 196 TVKDV VK A+HLK++GK+++P D+VKT R KELAPYDPDW+Y+R A++ R I Sbjct: 6 TVKDVSPHDFVKAYASHLKRSGKIELPLWTDIVKTGRLKELAPYDPDWYYIRAASMARKI 65 Query: 197 YIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILT 376 Y+R +GV +I+GG KRNG P HFC+SSG IAR LQ LE + +VE GGR +T Sbjct: 66 YLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGIARHILQQLETMSIVELDTKGGRRIT 125 Query: 377 TQGRRDLDRI 406 + G+RDLD++ Sbjct: 126 SSGQRDLDQV 135 >At3g02080.1 68416.m00173 40S ribosomal protein S19 (RPS19A) similar to 40S ribosomal protein S19 GB:P40978 [Oryza sativa] Length = 143 Score = 157 bits (381), Expect = 4e-39 Identities = 68/130 (52%), Positives = 93/130 (71%) Frame = +2 Query: 17 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 196 TVKDV VK A+HLK++GK+++P D+VKT + KELAPYDPDW+Y+R A++ R + Sbjct: 6 TVKDVSPHDFVKAYASHLKRSGKIELPTWTDIVKTGKLKELAPYDPDWYYIRAASMARKV 65 Query: 197 YIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILT 376 Y+R +GV +I+GG KRNG P HFC+SSG IAR LQ LE + +VE GGR +T Sbjct: 66 YLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGIARHILQQLETMNIVELDTKGGRRIT 125 Query: 377 TQGRRDLDRI 406 + G+RDLD++ Sbjct: 126 SSGQRDLDQV 135 >At5g61170.1 68418.m07674 40S ribosomal protein S19 (RPS19C) 40S ribsomal protein S19, Oryza sativa, SWISSPROT:RS19_ORYSA Length = 143 Score = 155 bits (377), Expect = 1e-38 Identities = 66/130 (50%), Positives = 94/130 (72%) Frame = +2 Query: 17 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 196 TVKDV + VK AAHLK++GK+++P D+VKT + KELAPYDPDW+Y+R A++ R + Sbjct: 6 TVKDVSPHEFVKAYAAHLKRSGKIELPLWTDIVKTGKLKELAPYDPDWYYIRAASMARKV 65 Query: 197 YIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILT 376 Y+R +GV +I+GG KRNG P HFC+SSG +AR LQ L+ + +V+ GGR +T Sbjct: 66 YLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGVARHILQQLQTMNIVDLDTKGGRKIT 125 Query: 377 TQGRRDLDRI 406 + G+RDLD++ Sbjct: 126 SSGQRDLDQV 135 >At4g16095.1 68417.m02440 disease resistance protein-related contains weak similarity to rpp8 [Arabidopsis thaliana] gi|3901294|gb|AAC78631 Length = 187 Score = 29.5 bits (63), Expect = 1.4 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 362 HRPELSQQASMPPTIAKPCVQYCLM 288 H P L Q PP + C++YC M Sbjct: 86 HMPRLPDQHRFPPNLTNICLRYCCM 110 >At5g45800.1 68418.m05632 leucine-rich repeat transmembrane protein kinase, putative Length = 666 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/50 (24%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +2 Query: 62 AHLKKTGKVKVPEHMDLVK-TARFKELAPYDPDWFYVRCAAILRHIYIRS 208 +H + V P D + T F+ ++ ++ WF C+A++ H+ + S Sbjct: 15 SHSDSSSTVSCPNGTDFHQLTTVFRYVSGFNSSWFSSNCSAVITHVVLPS 64 >At1g14300.1 68414.m01695 expressed protein contains Pfam PF04063: Domain of unknown function (DUF383) and PF04064: Domain of unknown function (DUF384) Length = 339 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +2 Query: 278 FCRSSGSIARKALQSLEALKL-VEKVQDGGRILTTQGRRDLDRI 406 FCRSSG A + + ++ + + K +DG ++L RR L +I Sbjct: 143 FCRSSGETADDQFEHVGSILVNISKTEDGRKLLLEPKRRLLKQI 186 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 27.1 bits (57), Expect = 7.3 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 26 DVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELA 142 +VE D+ V A K+T + + E VKT F+ELA Sbjct: 30 NVEHDEFRPPVVATTKRTEEREPAEQQPPVKTFNFRELA 68 >At3g24000.1 68416.m03014 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 633 Score = 27.1 bits (57), Expect = 7.3 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +2 Query: 215 GVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVE--KVQDGGRILTTQGR 388 G + ++F G R+G PSHF +S A + LE K V ++ G +++ G Sbjct: 242 GTEKALELFQGMLRDGFRPSHFSYASLFGACSSTGFLEQGKWVHAYMIKSGEKLVAFAGN 301 Query: 389 RDLD 400 LD Sbjct: 302 TLLD 305 >At2g02480.1 68415.m00187 DNA polymerase-related weak similarity to DNA polymerase III holoenzyme tau subunit [Thermus thermophilus] GI:2583049 Length = 1218 Score = 27.1 bits (57), Expect = 7.3 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = -2 Query: 402 LSRSRLPCVVRMRXXXXXXXXXFNASNDCKALRAILPDDLQKCEGVTPLRLR 247 +S SRL C+ + + NA +D +DL+K G +PL L+ Sbjct: 178 ISSSRLDCLSKYQPRDDIVARNCNAGSDDTEEELSNSEDLRKVTGASPLLLK 229 >At4g37360.1 68417.m05291 cytochrome P450 family protein cytochrome P450 monooxygenase, Arabidopsis thaliana, PID:d1029478 Length = 499 Score = 26.6 bits (56), Expect = 9.7 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 273 HISAGHQAVLHARLCNRWRH*SLLRKFRTVVAFSPHKVD 389 HIS G+ V+ A WR+ LR+ + FS H+++ Sbjct: 108 HISYGNSTVVSASYSEHWRN---LRRIGALEIFSAHRLN 143 >At1g43620.2 68414.m05008 UDP-glucose:sterol glucosyltransferase, putative similar to UDP-glucose:sterol glucosyltransferase [Arabidopsis thaliana] GI:2462931; contains Pfam profile: PF03033 glycosyltransferase family 28 N-terminal domain Length = 615 Score = 26.6 bits (56), Expect = 9.7 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = +2 Query: 17 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRH 193 T+KD EQ IV L +VPE++ LV E P+D W + +C+A++ H Sbjct: 433 TLKDTEQRGIVDRGWGGLGNLA-TEVPENVFLV------EDCPHD--WLFPQCSAVVHH 482 >At1g43620.1 68414.m05007 UDP-glucose:sterol glucosyltransferase, putative similar to UDP-glucose:sterol glucosyltransferase [Arabidopsis thaliana] GI:2462931; contains Pfam profile: PF03033 glycosyltransferase family 28 N-terminal domain Length = 615 Score = 26.6 bits (56), Expect = 9.7 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = +2 Query: 17 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRH 193 T+KD EQ IV L +VPE++ LV E P+D W + +C+A++ H Sbjct: 433 TLKDTEQRGIVDRGWGGLGNLA-TEVPENVFLV------EDCPHD--WLFPQCSAVVHH 482 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,988,650 Number of Sequences: 28952 Number of extensions: 196598 Number of successful extensions: 444 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 441 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 444 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 917929344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -