BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31340 (586 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 24 4.2 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 23 9.6 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 160 DGPYLWKVHLVTLGNTLAIGSTRSSGSISVKLTTS 56 D PYLW V +T+ L R+ + V+L T+ Sbjct: 459 DIPYLWSVTDLTISPILPTNHARTVSNRFVRLFTN 493 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 22.6 bits (46), Expect = 9.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 Query: 236 LVLVYDTIYPEWNFFVIPHGRCRW 307 L LVY T E ++ HG C W Sbjct: 861 LSLVYYTYKLELKVWLFKHGLCLW 884 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,780 Number of Sequences: 2352 Number of extensions: 13252 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -