BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31339 (513 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 23 2.4 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 4.3 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 4.3 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 22 4.3 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 5.7 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 21 9.9 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.6 bits (46), Expect = 2.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 32 MLGAISRVGSGILSVKSVAEKSLSECGKIVAVN 130 MLG +S +G+G++ ++ KSL + +N Sbjct: 61 MLGFVSAMGNGMVVYIFLSTKSLRTPSNLFVIN 93 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 23 FLKMLGAISRVGSG 64 FLK LGA+ GSG Sbjct: 172 FLKKLGAVDIAGSG 185 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 4.3 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 269 RSPRLVLEVAQHLGENTVRTIAMDGTE 349 RSP + ++AQ+ G N + A+D T+ Sbjct: 897 RSPDTLRKIAQNRGTNPLAPDAVDLTQ 923 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 21.8 bits (44), Expect = 4.3 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 32 MLGAISRVGSGILSVKSVAEKSLSECGKIVAVN 130 MLG +S +G+G++ ++ KSL + +N Sbjct: 27 MLGFVSVMGNGMVVYIFLSTKSLRTPSNLFVIN 59 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 338 DGTEGLVRGQPVLDSGSPI 394 DGTEG+ + VL PI Sbjct: 193 DGTEGIAKSGDVLVETEPI 211 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -3 Query: 292 LKYEAGRSILHLKGI*NRRQVIFELHIYH 206 L+ + ++HLK I + ++ +IYH Sbjct: 100 LRDSVTKYLIHLKEIEDTEPILLIAYIYH 128 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,671 Number of Sequences: 438 Number of extensions: 2998 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14232156 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -