BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31339 (513 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondria... 140 7e-34 At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial,... 140 7e-34 At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondria... 140 7e-34 At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial... 44 6e-05 At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putati... 35 0.028 At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putati... 35 0.028 At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATP... 35 0.037 At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putati... 35 0.037 At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putati... 35 0.037 At3g54040.1 68416.m05975 photoassimilate-responsive protein-rela... 31 0.46 At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN ... 30 1.1 At1g69410.1 68414.m07972 eukaryotic translation initiation facto... 29 2.4 At3g62640.1 68416.m07036 expressed protein 28 4.2 At5g60450.1 68418.m07582 auxin-responsive factor (ARF4) contains... 27 5.6 At5g39880.1 68418.m04837 expressed protein 27 7.4 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 27 7.4 At2g33100.1 68415.m04058 cellulose synthase family protein simil... 27 7.4 At2g43440.1 68415.m05399 F-box family protein contains Pfam PF00... 27 9.8 At1g51910.1 68414.m05851 protein kinase family protein contains ... 27 9.8 >At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondrial identical to SP|P83484 ATP synthase beta chain 2, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452187|dbj|AK118582.1| Length = 556 Score = 140 bits (338), Expect = 7e-34 Identities = 67/102 (65%), Positives = 82/102 (80%), Gaps = 2/102 (1%) Frame = +2 Query: 212 DVQFEDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVLDSG 385 DV+FED LPPI+ +LEVQ+ RLVLEV+ HLG+N VRTIAMDGTEGLVRG+ VL++G Sbjct: 95 DVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVLNTG 154 Query: 386 SPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAEAP 511 +PI +PVG TLGRI+NV+GEPIDERG I T+ IH +AP Sbjct: 155 APITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAP 196 >At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial, putative strong similarity to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}, SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 559 Score = 140 bits (338), Expect = 7e-34 Identities = 67/102 (65%), Positives = 82/102 (80%), Gaps = 2/102 (1%) Frame = +2 Query: 212 DVQFEDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVLDSG 385 DV+FED LPPI+ +LEVQ+ RLVLEV+ HLG+N VRTIAMDGTEGLVRG+ VL++G Sbjct: 98 DVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVLNTG 157 Query: 386 SPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAEAP 511 +PI +PVG TLGRI+NV+GEPIDERG I T+ IH +AP Sbjct: 158 APITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAP 199 >At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondrial identical to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452102|dbj|AK118538.1| Length = 556 Score = 140 bits (338), Expect = 7e-34 Identities = 67/102 (65%), Positives = 82/102 (80%), Gaps = 2/102 (1%) Frame = +2 Query: 212 DVQFEDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVLDSG 385 DV+FED LPPI+ +LEVQ+ RLVLEV+ HLG+N VRTIAMDGTEGLVRG+ VL++G Sbjct: 95 DVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVLNTG 154 Query: 386 SPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAEAP 511 +PI +PVG TLGRI+NV+GEPIDERG I T+ IH +AP Sbjct: 155 APITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAP 196 >At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial, putative very strong similarity to SP|P23413 ATP synthase alpha chain, mitochondrial (EC 3.6.3.14) {Brassica campestris}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 777 Score = 44.0 bits (99), Expect = 6e-05 Identities = 20/73 (27%), Positives = 36/73 (49%) Frame = +2 Query: 293 VAQHLGENTVRTIAMDGTEGLVRGQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPI 472 +A +L V + G + G V +GS + +P G LGR+++ +G PID +G + Sbjct: 334 MALNLENENVGIVVFGGDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDAMGVPIDGKGAL 393 Query: 473 PTDKTAAIHAEAP 511 + + +AP Sbjct: 394 SDHEQRRVEVKAP 406 >At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 35.1 bits (77), Expect = 0.028 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 308 GENTVRTIAMDGTEGLVRGQPVLD-SGSPIRIPVGAETLGRIINVIGEPIDERGPI 472 GE V + +GT G+ + +G ++ PV + LGRI N G+PID PI Sbjct: 64 GEKAVVQV-FEGTSGIDNKYTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPI 118 >At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 35.1 bits (77), Expect = 0.028 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 308 GENTVRTIAMDGTEGLVRGQPVLD-SGSPIRIPVGAETLGRIINVIGEPIDERGPI 472 GE V + +GT G+ + +G ++ PV + LGRI N G+PID PI Sbjct: 64 GEKAVVQV-FEGTSGIDNKYTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPI 118 >At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATPase B subunit / vacuolar proton pump B subunit / V-ATPase 57 kDa subunit identical to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana} Length = 486 Score = 34.7 bits (76), Expect = 0.037 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +2 Query: 308 GENTVRTIAMDGTEGLV-RGQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPI 472 GE V + +GT G+ + V +G ++ PV + LGRI N G+PID PI Sbjct: 63 GEKAVVQV-FEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPI 117 >At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 485 Score = 34.7 bits (76), Expect = 0.037 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +2 Query: 308 GENTVRTIAMDGTEGLV-RGQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPI 472 GE V + +GT G+ + V +G ++ PV + LGRI N G+PID PI Sbjct: 63 GEKAVVQV-FEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPI 117 >At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 330 Score = 34.7 bits (76), Expect = 0.037 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +2 Query: 308 GENTVRTIAMDGTEGLV-RGQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPI 472 GE V + +GT G+ + V +G ++ PV + LGRI N G+PID PI Sbjct: 63 GEKAVVQV-FEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPI 117 >At3g54040.1 68416.m05975 photoassimilate-responsive protein-related contains weak similarity to mRNA inducible by sucrose and salicylic acid expressed in sugar-accumulating tobacco plants (GI:871487) [Nicotiana tabacum] Length = 183 Score = 31.1 bits (67), Expect = 0.46 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = +2 Query: 227 DNLPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLV 358 +NLP + + + R +LE A GE T RT A+D EG+V Sbjct: 29 ENLPTNMCSFSISASGKRCILETANVAGEFTCRTSAVD-VEGIV 71 >At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN protein (ETT) identical to ETTIN GB:AF007788 from [Arabidopsis thaliana] Length = 608 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 317 CSHPNVGLPQVRGGEIDFAPQGHLESEAGY-LRIAHLPQH 201 C+ P + LP+ RG + + PQGHLE + I LP H Sbjct: 59 CAGPLISLPK-RGSLVLYFPQGHLEQAPDFSAAIYGLPPH 97 >At1g69410.1 68414.m07972 eukaryotic translation initiation factor 5A, putative / eIF-5A, putative strong similarity to eukaryotic initiation factor 5A (2) (Nicotiana plumbaginifolia) GI:19702, SP|Q9AXQ6| Eukaryotic translation initiation factor 5A-1 (eIF-5A 1) {Lycopersicon esculentum} Length = 158 Score = 28.7 bits (61), Expect = 2.4 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -3 Query: 457 VNRFADY--IDDASEGFSSHRDTNG*ARVEYRLPTD*AFSTVHGNG 326 VNR DY ID + +GF S NG + + +LPTD A T NG Sbjct: 85 VNR-VDYQLIDISEDGFVSLLTDNGSTKDDLKLPTDEALLTQLKNG 129 >At3g62640.1 68416.m07036 expressed protein Length = 110 Score = 27.9 bits (59), Expect = 4.2 Identities = 16/65 (24%), Positives = 27/65 (41%) Frame = -1 Query: 417 VSAPTGIRMGEPESSTGCPRTKPSVPSMAMVRTVFSPKCWATSSTRRGDRFCTSRAFRIG 238 V T + P+S P P S + RT +P + T+R R T + + + Sbjct: 27 VGGTTQVYSTRPDSPKFQPSIPPPPGSTSKTRTTATPWRLIDAETKRKKRIATYKTYALE 86 Query: 237 GRLSS 223 G++ S Sbjct: 87 GKVKS 91 >At5g60450.1 68418.m07582 auxin-responsive factor (ARF4) contains Pfam profile: PF02362 B3 DNA binding domain; identical to cDNA auxin response factor 4 (ARF4) GI:4102597 Length = 788 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 317 CSHPNVGLPQVRGGEIDFAPQGHLESEA 234 C+ P LP+ +G + + PQGHLE +A Sbjct: 70 CAGPLTCLPK-KGNVVVYFPQGHLEQDA 96 >At5g39880.1 68418.m04837 expressed protein Length = 363 Score = 27.1 bits (57), Expect = 7.4 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +3 Query: 120 LQSMPLTRGTMLLNLQEKAKVRLLPLSVLW*MCNSKITCL 239 LQ++P T T +LN +E++ + ++ MC +T L Sbjct: 44 LQTLPFTEITEILNRKERSAPKTPEFKAMFTMCKGYVTYL 83 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 27.1 bits (57), Expect = 7.4 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 2/80 (2%) Frame = -1 Query: 453 IGSPI-TLMMRPRVSAPTGIRMGEPESSTGCPRTKPSVPSMAMVRTVFSPKCWATSSTRR 277 +GSP+ TLM R S+ S+G KPSV S R + K + + Sbjct: 40 LGSPVSTLMPRGSASSSAAATPTSSSGSSGSASGKPSVSSQMAKRLDDAYKSHSGELSSP 99 Query: 276 GDRF-CTSRAFRIGGRLSSN 220 G T+R + G R SS+ Sbjct: 100 GSGMPTTTRILKPGHRRSSS 119 >At2g33100.1 68415.m04058 cellulose synthase family protein similar to gi:2827143 from Arabidopsis thaliana (Ath-B) Length = 1036 Score = 27.1 bits (57), Expect = 7.4 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -1 Query: 399 IRMGEPESSTGCPRTKPSVPSMAMVRTVFSPKCWATSSTRRGDR 268 ++ G P + PR P++A V S CW +T GDR Sbjct: 689 VKNGRPPGALLLPRPPLDAPTVAEAIAVIS--CWYEDNTEWGDR 730 >At2g43440.1 68415.m05399 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 791 Score = 26.6 bits (56), Expect = 9.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 401 GYEWVSQSRVQVAHGLSLQYRPWQ 330 GY W + +AHG+ + PWQ Sbjct: 275 GYSWSKSYSISLAHGVGFSW-PWQ 297 >At1g51910.1 68414.m05851 protein kinase family protein contains Serine/Threonine protein kinases active-site signature, PROSITE:PS00108 Length = 876 Score = 26.6 bits (56), Expect = 9.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 233 LPPILNALEVQNRSPRLVLEVAQ 301 LPP++NALEV L+LE Q Sbjct: 343 LPPLINALEVYTLVENLLLETYQ 365 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,688,772 Number of Sequences: 28952 Number of extensions: 248601 Number of successful extensions: 651 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -