BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31336 (649 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0500 + 19735879-19736144,19736325-19736664,19738181-19738831 29 2.4 02_05_0640 - 30558523-30559027,30559123-30559252,30559388-305598... 29 3.2 11_02_0029 + 7533705-7534193,7535532-7535729,7536998-7537168,753... 27 9.7 >12_02_0500 + 19735879-19736144,19736325-19736664,19738181-19738831 Length = 418 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -1 Query: 247 GGT--SACTSA*IQAAWALLSRWGSLVVEVRLPQAWLAGR 134 GGT A TSA +AA L G V R+P+ W GR Sbjct: 341 GGTVREAATSARCEAAMGALYALGVAVYAARVPERWFPGR 380 >02_05_0640 - 30558523-30559027,30559123-30559252,30559388-30559868, 30560292-30560346,30560537-30560613,30561228-30561315, 30561490-30561593,30562050-30562231,30562347-30563109, 30563195-30563438,30564513-30564658,30565158-30565283, 30565404-30565517,30565595-30565762,30566283-30566528, 30566605-30566767,30566970-30567064,30567274-30567357, 30567769-30568055,30568359-30568572,30568923-30569140, 30569386-30569623,30570312-30571118,30571202-30571301, 30571694-30571737,30571824-30571973 Length = 1942 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 163 RLPQAWLAGRPPYRVRLQKQPG 98 R P+ WL +PP RV LQK G Sbjct: 1038 RSPEHWLKNQPPKRVELQKALG 1059 >11_02_0029 + 7533705-7534193,7535532-7535729,7536998-7537168, 7537274-7537609 Length = 397 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 484 SCGNAGTWRLRKCDGVTIDLG 422 SCG+ G WR++ C VT G Sbjct: 291 SCGSNGVWRVQDCLAVTRSFG 311 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,947,078 Number of Sequences: 37544 Number of extensions: 305841 Number of successful extensions: 776 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 775 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -