BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31336 (649 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15393| Best HMM Match : Peptidase_M16_C (HMM E-Value=6.6e-05) 30 1.9 SB_59387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 >SB_15393| Best HMM Match : Peptidase_M16_C (HMM E-Value=6.6e-05) Length = 683 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = +1 Query: 310 RRNKGQRVEPPRAQTWGERALRTYLANRPITYTQKSKNQDQSLLHHISVGAK 465 R +K +++ + WGE R Y +R TY+ + Q+++ L ISV + Sbjct: 515 RLDKPKKLRTETQKHWGEILTRQYNFDRACTYSGRGDLQERTTLASISVSLR 566 >SB_59387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 316 NKGQRVEPPRAQTWGERALRTYLANRPITYTQKSKNQD 429 N ++ EP G+ L T AN+P+ +T ++KN D Sbjct: 672 NSRKKTEPANCTVSGD-GLTTGAANQPVKFTVRTKNPD 708 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,792,218 Number of Sequences: 59808 Number of extensions: 334336 Number of successful extensions: 746 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -