Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31336
         (649 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g03040.1 68418.m00252 calmodulin-binding family protein simil...    28   6.1  

>At5g03040.1 68418.m00252 calmodulin-binding family protein similar
           to SF16 protein [Helianthus annuus] GI:560150; contains
           Pfam profile PF00612: IQ calmodulin-binding motif
          Length = 291

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = +1

Query: 340 PRAQTWGERALRTYLANRPITYTQKSKNQDQ 432
           P   TWG   L  ++A RP+  ++K + Q Q
Sbjct: 260 PSNPTWGWSWLERWMAGRPLESSEKEQKQQQ 290


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,268,159
Number of Sequences: 28952
Number of extensions: 225756
Number of successful extensions: 546
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 528
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 546
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1344285648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)