BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31335 (669 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13698| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_20844| Best HMM Match : Ion_trans (HMM E-Value=0) 28 6.0 >SB_13698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 452 TKQRLFLTILLGFYFTILQAYEYIEASFTIADRIYGSTFFI 574 T R+FL IL+ F L + Y A+FT ++ T FI Sbjct: 247 TGSRMFLDILIAFIIPYLLWFAYTIANFTFKPKLSFETEFI 287 >SB_20844| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 2675 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/86 (20%), Positives = 37/86 (43%) Frame = +2 Query: 374 NTIILIRSGVTVT*AHHSLIENNFSQTKQRLFLTILLGFYFTILQAYEYIEASFTIADRI 553 + II+I++ + HH + N + + + I++ T++ + +D Sbjct: 2244 SNIIIIKNNTIINTHHHVITSNKITTFNTTVIIIIIIIIITTVIVTTKIRTLDLQPSDES 2303 Query: 554 YGSTFFIATGFHGIHVIIGTLFLLNL 631 S + F I ++IG F+LNL Sbjct: 2304 NFSGYI----FFVIFILIGAFFVLNL 2325 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,622,298 Number of Sequences: 59808 Number of extensions: 222819 Number of successful extensions: 310 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 310 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -