BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31328 (344 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 3.2 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 22 5.6 AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 prot... 21 9.7 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 21 9.7 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 21 9.7 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -3 Query: 213 ARADVTTHTKKSSNWRHLMSEQFQCTIE 130 AR +++ H K S+ W + +E + T E Sbjct: 1010 ARQEMSKHRKGSAEWNKINNEAHKTTRE 1037 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/33 (27%), Positives = 21/33 (63%) Frame = +3 Query: 24 SNAVIIFKRKSINGNNNNIDIVYFVK*LVTCKL 122 +N ++I++ ++ ++ +ID+ YF + TC L Sbjct: 136 NNGMVIWQPPAVYKSSCSIDVEYFPYDVQTCVL 168 >AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 protein. Length = 128 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -3 Query: 216 YARADVTTHTKKSSNWRHLMSEQFQCT 136 Y+ ADV +H S W + ++ + T Sbjct: 7 YSLADVKSHNTNKSTWIVIHNDIYDVT 33 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 258 LWLREGIGNTQSTWYARADVTTHTKK 181 LWL T+ W A++D T+K Sbjct: 123 LWLLSQTWITRHLWMAKSDRNASTEK 148 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 21.4 bits (43), Expect = 9.7 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -3 Query: 297 KKAKASTIPLPRELWLREGIGNTQSTWYAR 208 K A+ + P E W RE T +W R Sbjct: 845 KLARIAERPYSVEAWQREWSTTTSGSWTRR 874 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 351,314 Number of Sequences: 2352 Number of extensions: 5495 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24505155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -