BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31326 (628 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.1 AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 23 3.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.3 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 7.4 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 9.8 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 9.8 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.2 bits (50), Expect = 1.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 614 RIPSNLAATKASPGSDTASANVWRRTLSPPTVTSS 510 R S + KA PGS A + ++ LSP + SS Sbjct: 886 RPASQATSVKAEPGSIMAMSESSKKVLSPGELLSS 920 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 22.6 bits (46), Expect = 3.2 Identities = 8/36 (22%), Positives = 20/36 (55%) Frame = +3 Query: 72 RLLKTTMGKISLFFLALIASSVMALYRVPLHRMKTA 179 R+++ +GK+ + + + V++LY P+ + A Sbjct: 76 RVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAA 111 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 4.3 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +1 Query: 340 TPDPPTFWVPSKKCHY 387 T PP W P KC++ Sbjct: 414 TSPPPEDWKPLDKCYF 429 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 7.4 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +3 Query: 93 GKISLFFLALIASSVMALYRVPLHRMKTARTHFHEVGTELELLRLKYDVTGPSPEPL 263 GK+++ + S + ++ V L + VG +E+ K DVTG P PL Sbjct: 289 GKLNVNEFYMAFSKLYSVSVVSLDKSLEVNHISARVGDNVEI---KCDVTGTPPPPL 342 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 264 SNYLDAQYYGVISIGTPP 317 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 264 SNYLDAQYYGVISIGTPP 317 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 264 SNYLDAQYYGVISIGTPP 317 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 264 SNYLDAQYYGVISIGTPP 317 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 264 SNYLDAQYYGVISIGTPP 317 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 264 SNYLDAQYYGVISIGTPP 317 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 264 SNYLDAQYYGVISIGTPP 317 +NY QYY +I+I P Sbjct: 107 TNYKKLQYYNIINIEQIP 124 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 264 SNYLDAQYYGVISIGTPP 317 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,035 Number of Sequences: 438 Number of extensions: 3970 Number of successful extensions: 14 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -