BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31326 (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11910.1 68414.m01374 aspartyl protease family protein contai... 114 5e-26 At4g04460.1 68417.m00648 aspartyl protease family protein contai... 108 3e-24 At1g62290.1 68414.m07027 aspartyl protease family protein contai... 107 5e-24 At4g22050.1 68417.m03189 aspartyl protease family protein contai... 77 1e-14 At1g69100.1 68414.m07907 aspartyl protease family protein contai... 49 2e-06 At3g51350.1 68416.m05622 aspartyl protease family protein contai... 37 0.013 At3g42550.1 68416.m04414 aspartyl protease family protein weak s... 36 0.022 At3g12700.1 68416.m01587 aspartyl protease family protein contai... 36 0.029 At1g08210.1 68414.m00907 aspartyl protease family protein contai... 33 0.12 At5g45120.1 68418.m05539 aspartyl protease family protein contai... 33 0.21 At2g42980.1 68415.m05332 aspartyl protease family protein contai... 31 0.63 At2g36670.2 68415.m04498 aspartyl protease family protein contai... 31 0.63 At5g22850.1 68418.m02671 aspartyl protease family protein contai... 31 0.83 At3g52500.1 68416.m05773 aspartyl protease family protein contai... 31 0.83 At1g66180.1 68414.m07512 aspartyl protease family protein contai... 31 0.83 At3g51340.1 68416.m05620 aspartyl protease family protein contai... 30 1.1 At1g44130.1 68414.m05097 nucellin protein, putative similar to n... 30 1.1 At1g05840.1 68414.m00611 aspartyl protease family protein contai... 30 1.1 At5g43100.1 68418.m05261 aspartyl protease family protein low si... 30 1.4 At2g36670.1 68415.m04497 aspartyl protease family protein contai... 30 1.4 At5g10080.1 68418.m01168 aspartyl protease family protein contai... 29 1.9 At5g02190.1 68418.m00140 aspartyl protease family protein contai... 29 1.9 At3g25700.1 68416.m03198 chloroplast nucleoid DNA-binding protei... 29 1.9 At3g59080.1 68416.m06586 aspartyl protease family protein contai... 29 2.5 At3g51360.1 68416.m05624 aspartyl protease family protein contai... 29 2.5 At2g28010.1 68415.m03394 aspartyl protease family protein contai... 29 2.5 At1g77480.2 68414.m09023 nucellin protein, putative similar to n... 29 2.5 At1g77480.1 68414.m09022 nucellin protein, putative similar to n... 29 2.5 At1g64830.1 68414.m07350 aspartyl protease family protein contai... 29 2.5 At1g31450.1 68414.m03851 aspartyl protease family protein contai... 29 2.5 At5g10760.1 68418.m01250 aspartyl protease family protein contai... 28 4.4 At4g01910.1 68417.m00251 DC1 domain-containing protein contains ... 28 4.4 At3g50050.1 68416.m05472 aspartyl protease family protein contai... 28 4.4 At3g02740.1 68416.m00266 aspartyl protease family protein contai... 28 4.4 At2g28040.1 68415.m03399 aspartyl protease family protein contai... 28 4.4 At1g65240.1 68414.m07396 aspartyl protease family protein contai... 28 5.8 At5g36260.1 68418.m04374 aspartyl protease family protein contai... 27 7.7 At5g33340.1 68418.m03957 aspartyl protease family protein contai... 27 7.7 At3g51330.1 68416.m05619 aspartyl protease family protein contai... 27 7.7 At3g18490.1 68416.m02350 aspartyl protease family protein contai... 27 7.7 At2g35615.1 68415.m04367 aspartyl protease family protein contai... 27 7.7 >At1g11910.1 68414.m01374 aspartyl protease family protein contains Pfam profiles: PF00026 eukaryotic aspartyl protease, PF03489 surfactant protein B, PF05184 saposin-like type B, region 1 Length = 506 Score = 114 bits (274), Expect = 5e-26 Identities = 52/89 (58%), Positives = 64/89 (71%) Frame = +1 Query: 361 WVPSKKCHYTNIACLLHNKYDSRKSKTYVANGTQFAIQYGSGSLSGFLSTDDVTVGGLKV 540 WVPS KC+++ +ACLLH KY S +S TY NG AI YG+G+++GF S D VTVG L V Sbjct: 107 WVPSSKCYFS-LACLLHPKYKSSRSSTYEKNGKAAAIHYGTGAIAGFFSNDAVTVGDLVV 165 Query: 541 RRQTFAEAVSEPGLAFVAAKFDGILGMAF 627 + Q F EA EPG+ FV AKFDGILG+ F Sbjct: 166 KDQEFIEATKEPGITFVVAKFDGILGLGF 194 Score = 63.3 bits (147), Expect = 1e-10 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +3 Query: 261 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNL 359 L NYLDAQYYG I+IGTPPQ F VVFDTGSSNL Sbjct: 74 LKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNL 106 >At4g04460.1 68417.m00648 aspartyl protease family protein contains Pfam profiles: PF00026 eukaryotic aspartyl protease, PF03489 surfactant protein B, PF05184 saposin-like type B, region 1 Length = 508 Score = 108 bits (259), Expect = 3e-24 Identities = 46/89 (51%), Positives = 64/89 (71%) Frame = +1 Query: 361 WVPSKKCHYTNIACLLHNKYDSRKSKTYVANGTQFAIQYGSGSLSGFLSTDDVTVGGLKV 540 W+PS KC Y ++AC H+KY + +S +Y NG +I+YG+G++SG+ S DDV VG + V Sbjct: 112 WIPSTKC-YLSVACYFHSKYKASQSSSYRKNGKPASIRYGTGAISGYFSNDDVKVGDIVV 170 Query: 541 RRQTFAEAVSEPGLAFVAAKFDGILGMAF 627 + Q F EA SEPG+ F+ AKFDGILG+ F Sbjct: 171 KEQEFIEATSEPGITFLLAKFDGILGLGF 199 Score = 65.3 bits (152), Expect = 3e-11 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 258 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNL 359 PL NYLDAQYYG I+IGTPPQ F V+FDTGSSNL Sbjct: 78 PLKNYLDAQYYGDITIGTPPQKFTVIFDTGSSNL 111 >At1g62290.1 68414.m07027 aspartyl protease family protein contains Pfam profiles: PF00026 eukaryotic aspartyl protease, PF03489 surfactant protein B, PF05184 saposin-like type B, region 1 Length = 513 Score = 107 bits (258), Expect = 5e-24 Identities = 50/89 (56%), Positives = 62/89 (69%) Frame = +1 Query: 361 WVPSKKCHYTNIACLLHNKYDSRKSKTYVANGTQFAIQYGSGSLSGFLSTDDVTVGGLKV 540 WVPS KC ++ ++C H KY S +S TY +G + AI YGSGS+SGF S D VTVG L V Sbjct: 114 WVPSGKCFFS-LSCYFHAKYKSSRSSTYKKSGKRAAIHYGSGSISGFFSYDAVTVGDLVV 172 Query: 541 RRQTFAEAVSEPGLAFVAAKFDGILGMAF 627 + Q F E SEPGL F+ AKFDG+LG+ F Sbjct: 173 KDQEFIETTSEPGLTFLVAKFDGLLGLGF 201 Score = 65.7 bits (153), Expect = 2e-11 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 258 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNL 359 PL NYLDAQYYG I+IGTPPQ F V+FDTGSSNL Sbjct: 80 PLKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNL 113 >At4g22050.1 68417.m03189 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 354 Score = 76.6 bits (180), Expect = 1e-14 Identities = 41/92 (44%), Positives = 55/92 (59%), Gaps = 1/92 (1%) Frame = +1 Query: 355 TFWVPSKKCHYTNIACLLHNKYDSRKSKTYVANGTQFAIQYGSGSLSGFLSTDDVTVGGL 534 + WVPS+ ++ N+Y S S+T+ NGT+ ++YG GSL+GFLS D VTVGG+ Sbjct: 69 SLWVPSE--NWLAKTENPRNRYISSASRTFKENGTKAELKYGKGSLTGFLSVDTVTVGGI 126 Query: 535 KVRRQTFAEAVSEPGLAFV-AAKFDGILGMAF 627 + QTF E V P F FDGILG+ F Sbjct: 127 SITSQTFIEGVKTPYKEFFKKMPFDGILGLRF 158 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = +3 Query: 261 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNL 359 L N D YYG I IG P Q+F V+FDTGSS+L Sbjct: 38 LKNVKDFLYYGKIQIGNPGQTFTVLFDTGSSSL 70 >At1g69100.1 68414.m07907 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 343 Score = 49.2 bits (112), Expect = 2e-06 Identities = 24/50 (48%), Positives = 32/50 (64%) Frame = +3 Query: 210 LELLRLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNL 359 + L R +V G S L N+ +YG IS+G+PPQ F VVFDTGS++L Sbjct: 22 ISLKRHTLNVGGTSFGGLKNFDGVVFYGEISVGSPPQKFNVVFDTGSTDL 71 >At3g51350.1 68416.m05622 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 36.7 bits (81), Expect = 0.013 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +3 Query: 273 LDAQYYGVISIGTPPQSFKVVFDTGS 350 L + YY +S+GTPP SF V DTGS Sbjct: 98 LGSLYYANVSVGTPPSSFLVALDTGS 123 >At3g42550.1 68416.m04414 aspartyl protease family protein weak similarity to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 356 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +3 Query: 273 LDAQYYGVISIGTPPQSFKVVFDTGS 350 L A YY + IGTPP+ VV DTGS Sbjct: 74 LSALYYTTVQIGTPPRELDVVIDTGS 99 >At3g12700.1 68416.m01587 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 461 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +3 Query: 267 NYLDAQYYGVISIGTPPQSFKVVFDTGS 350 +Y AQY+ I +GTP + F+VV DTGS Sbjct: 100 DYGTAQYFTEIRVGTPAKKFRVVVDTGS 127 >At1g08210.1 68414.m00907 aspartyl protease family protein contains Pfam profile PF00026: Eukaryotic aspartyl protease; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) {Nicotiana tabacum} Length = 492 Score = 33.5 bits (73), Expect = 0.12 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 270 YLDAQYYGVISIGTPPQSFKVVFDTGSSNL 359 +L YY + +GTPP+ F V DTGS L Sbjct: 79 FLVGLYYTKVKLGTPPREFNVQIDTGSDVL 108 >At5g45120.1 68418.m05539 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 491 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +3 Query: 255 EPLSNYLDAQYYGVISIGTPPQSFKVVFDTGS 350 EPL D Y ++IGTPPQ+ +V DTGS Sbjct: 74 EPLREVRDG-YLITLNIGTPPQAVQVYLDTGS 104 >At2g42980.1 68415.m05332 aspartyl protease family protein contains pfam profile: PF00026 eukaryotic aspartyl protease Length = 527 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 4/45 (8%) Frame = +3 Query: 282 QYYGVISIGTPPQSFKVVFDTGSSNLLGAFQKVP----LHQHRLF 404 +Y+ + +GTPP+ F ++ DTGS L Q +P HQ+ +F Sbjct: 159 EYFMDVLVGTPPKHFSLILDTGSD--LNWLQCLPCYDCFHQNGMF 201 >At2g36670.2 68415.m04498 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 507 Score = 31.1 bits (67), Expect = 0.63 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 270 YLDAQYYGVISIGTPPQSFKVVFDTGSSNL 359 YL Y+ + +G+PP F V DTGS L Sbjct: 95 YLVGLYFTKVKLGSPPTEFNVQIDTGSDIL 124 >At5g22850.1 68418.m02671 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 493 Score = 30.7 bits (66), Expect = 0.83 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +3 Query: 285 YYGVISIGTPPQSFKVVFDTGSSNL 359 YY + +GTPP+ F V DTGS L Sbjct: 81 YYTKLRLGTPPRDFYVQVDTGSDVL 105 >At3g52500.1 68416.m05773 aspartyl protease family protein contains Pfam PF00026: eukaryotic aspartyl protease Length = 469 Score = 30.7 bits (66), Expect = 0.83 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +3 Query: 258 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSS 353 PLS Y +S GTP Q+ VFDTGSS Sbjct: 81 PLSAKSYGGYSVSLSFGTPSQTIPFVFDTGSS 112 >At1g66180.1 68414.m07512 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease profile; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 430 Score = 30.7 bits (66), Expect = 0.83 Identities = 29/88 (32%), Positives = 41/88 (46%), Gaps = 7/88 (7%) Frame = +3 Query: 108 FFLALIASSVMALYRVPLHRMK-TARTHFHEVGTELELLRLKYDVTGPSPE-PLSNYLDA 281 FFL ++ S +PL + + T+ H T L L K PSP P N+ Sbjct: 12 FFLNYVSLSTSLSLHLPLTSLPISTTTNSHRFTTSL--LSRK----NPSPSSPPYNFRSR 65 Query: 282 QYYGV-----ISIGTPPQSFKVVFDTGS 350 Y + + IGTPPQ+ ++V DTGS Sbjct: 66 FKYSMALIISLPIGTPPQAQQMVLDTGS 93 >At3g51340.1 68416.m05620 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 518 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 267 NYLDAQYYGVISIGTPPQSFKVVFDTGS 350 N+L +Y +S+GTP F V DTGS Sbjct: 85 NFLGFLHYANVSLGTPATWFLVALDTGS 112 >At1g44130.1 68414.m05097 nucellin protein, putative similar to nucellin GI:2290202 from [Hordeum vulgare] Length = 405 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +3 Query: 258 PLS-NYLDAQYYGVI-SIGTPPQSFKVVFDTGS 350 PLS N YY V+ IG+PP++F+ DTGS Sbjct: 38 PLSGNVFPLGYYSVLMQIGSPPKAFQFDIDTGS 70 >At1g05840.1 68414.m00611 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease Length = 485 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 Query: 285 YYGVISIGTPPQSFKVVFDTGS 350 YY I IGTP +S+ V DTGS Sbjct: 80 YYAKIGIGTPAKSYYVQVDTGS 101 >At5g43100.1 68418.m05261 aspartyl protease family protein low similarity to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 631 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 Query: 303 IGTPPQSFKVVFDTGSS 353 IGTPPQ F ++ DTGS+ Sbjct: 82 IGTPPQEFALIVDTGST 98 >At2g36670.1 68415.m04497 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 512 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 231 YDVTGPS-PEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNL 359 + V G S P + + + Y+ + +G+PP F V DTGS L Sbjct: 86 FPVQGSSDPYLVGSKMTMLYFTKVKLGSPPTEFNVQIDTGSDIL 129 >At5g10080.1 68418.m01168 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 285 YYGVISIGTPPQSFKVVFDTGSSNLL 362 +Y I IGTP SF V DTG SNLL Sbjct: 100 HYTWIDIGTPSVSFLVALDTG-SNLL 124 >At5g02190.1 68418.m00140 aspartyl protease family protein contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 453 Score = 29.5 bits (63), Expect = 1.9 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 Query: 297 ISIGTPPQSFKVVFDTGS 350 +++GTPPQ+ +V DTGS Sbjct: 77 LTVGTPPQNISMVIDTGS 94 >At3g25700.1 68416.m03198 chloroplast nucleoid DNA-binding protein-related contains weak similarity to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 452 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 282 QYYGVISIGTPPQSFKVVFDTGS 350 QY+ + IG PPQS ++ DTGS Sbjct: 83 QYFVDLRIGQPPQSLLLIADTGS 105 >At3g59080.1 68416.m06586 aspartyl protease family protein contains similarity to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum]; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 535 Score = 29.1 bits (62), Expect = 2.5 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +3 Query: 282 QYYGVISIGTPPQSFKVVFDTGS 350 +Y+ + +G+PP+ F ++ DTGS Sbjct: 169 EYFMDVLVGSPPKHFSLILDTGS 191 >At3g51360.1 68416.m05624 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 488 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 Query: 285 YYGVISIGTPPQSFKVVFDTGS 350 +Y ++IGTP Q F V DTGS Sbjct: 89 HYANVTIGTPAQWFLVALDTGS 110 >At2g28010.1 68415.m03394 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 396 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 222 RLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGS 350 R+ +G SP + + ++ Y + +GTPP + + DTGS Sbjct: 44 RVSNTQSGSSPYANTVFDNSVYLMKLQVGTPPFEIQAIIDTGS 86 >At1g77480.2 68414.m09023 nucellin protein, putative similar to nucellin GB:AAB96882 GI:2290202 [Hordeum vulgare] (nucellin: similar to aspartic protease and its specific expression in nucellar cells during degeneration) Length = 432 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 285 YYGVISIGTPPQSFKVVFDTGS 350 YY +++IG PP+ F + DTGS Sbjct: 67 YYVLLNIGNPPKLFDLDIDTGS 88 >At1g77480.1 68414.m09022 nucellin protein, putative similar to nucellin GB:AAB96882 GI:2290202 [Hordeum vulgare] (nucellin: similar to aspartic protease and its specific expression in nucellar cells during degeneration) Length = 466 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 285 YYGVISIGTPPQSFKVVFDTGS 350 YY +++IG PP+ F + DTGS Sbjct: 67 YYVLLNIGNPPKLFDLDIDTGS 88 >At1g64830.1 68414.m07350 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 431 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 234 DVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGS 350 D + SP+ +Y ISIGTPP + DTGS Sbjct: 69 DASPNSPQSFITSNRGEYLMNISIGTPPVPILAIADTGS 107 >At1g31450.1 68414.m03851 aspartyl protease family protein contains eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 445 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 282 QYYGVISIGTPPQSFKVVFDTGS 350 +Y+ ISIGTPP + DTGS Sbjct: 84 EYFMSISIGTPPSKVFAIADTGS 106 >At5g10760.1 68418.m01250 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 464 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 285 YYGVISIGTPPQSFKVVFDTGS 350 Y I IGTP +VFDTGS Sbjct: 132 YIVTIGIGTPKHDLSLVFDTGS 153 >At4g01910.1 68417.m00251 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 651 Score = 28.3 bits (60), Expect = 4.4 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 11/48 (22%) Frame = -1 Query: 457 CHSRRTSWTCG---CRTC--------CAANKRCWCSGTFWKAPRRLED 347 CH R+ WTCG C+ C CA NK W P ED Sbjct: 314 CH-RKVDWTCGGFSCQRCSGYVVHSKCATNKDVWNGKELEGVPEETED 360 >At3g50050.1 68416.m05472 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease Length = 632 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 273 LDAQYYGVISIGTPPQSFKVVFDTGSS 353 ++ Y + IGTPPQ F ++ D+GS+ Sbjct: 89 INGYYTTRLWIGTPPQMFALIVDSGST 115 >At3g02740.1 68416.m00266 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 488 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 285 YYGVISIGTPPQSFKVVFDTGSSNL 359 Y+ I +GTP + F V DTGS L Sbjct: 85 YFAKIGLGTPSRDFHVQVDTGSDIL 109 >At2g28040.1 68415.m03399 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 395 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 282 QYYGVISIGTPPQSFKVVFDTGSSNL 359 +Y + IGTPP + V DTGS ++ Sbjct: 64 EYLMKLQIGTPPFEIEAVLDTGSEHI 89 >At1g65240.1 68414.m07396 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease profile; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 475 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 285 YYGVISIGTPPQSFKVVFDTGSSNL 359 Y+ I +G+PP+ + V DTGS L Sbjct: 74 YFTKIKLGSPPKEYHVQVDTGSDIL 98 >At5g36260.1 68418.m04374 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 482 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 285 YYGVISIGTPPQSFKVVFDTGSSNL 359 Y+ I +G+PP+ + V DTGS L Sbjct: 78 YFTKIKLGSPPKEYYVQVDTGSDIL 102 >At5g33340.1 68418.m03957 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 437 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +3 Query: 246 PSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNL 359 P P+ +Y +SIGTPP + DTGS L Sbjct: 77 PQPQIDLTSNSGEYLMNVSIGTPPFPIMAIADTGSDLL 114 >At3g51330.1 68416.m05619 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 529 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 285 YYGVISIGTPPQSFKVVFDTGS 350 +Y +S+GTP F V DTGS Sbjct: 102 HYANVSVGTPATWFLVALDTGS 123 >At3g18490.1 68416.m02350 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 500 Score = 27.5 bits (58), Expect = 7.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 282 QYYGVISIGTPPQSFKVVFDTGS 350 +Y+ I +GTP + +V DTGS Sbjct: 161 EYFSRIGVGTPAKEMYLVLDTGS 183 >At2g35615.1 68415.m04367 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 447 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 276 DAQYYGVISIGTPPQSFKVVFDTGS 350 D +++ I+IGTPP + DTGS Sbjct: 82 DGEFFMSITIGTPPIKVFAIADTGS 106 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,631,004 Number of Sequences: 28952 Number of extensions: 287535 Number of successful extensions: 981 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 940 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 979 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -