BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31324 (471 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosa... 29 0.27 SPBC418.02 |||NatA N-acetyltransferase complex subunit |Schizosa... 25 5.8 SPBC56F2.05c |||transcription factor |Schizosaccharomyces pombe|... 25 7.7 >SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 29.5 bits (63), Expect = 0.27 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 434 MFFPSWYKTNQSPICSLRATASICSC 357 +F P YKTN +PI L T ++CSC Sbjct: 256 IFTPILYKTNNNPII-LPITVTVCSC 280 >SPBC418.02 |||NatA N-acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 695 Score = 25.0 bits (52), Expect = 5.8 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 358 VAQGDCVRAASRDGRGVQRQRPCGIT-KKFHS 266 +A+ +CV DG + RQ+ G+ K+FHS Sbjct: 471 LAETECVWFLVEDGESLLRQKLYGLALKRFHS 502 >SPBC56F2.05c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 397 Score = 24.6 bits (51), Expect = 7.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 364 ALVAQGDCVRAASRDGRGVQRQRPCG 287 A +++ C R + +G RQRPCG Sbjct: 335 AAISRSRCSRC-KKSKKGCDRQRPCG 359 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,080,194 Number of Sequences: 5004 Number of extensions: 41982 Number of successful extensions: 125 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 180421690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -