BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31323 (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36445| Best HMM Match : ASC (HMM E-Value=5.6e-05) 27 7.6 >SB_36445| Best HMM Match : ASC (HMM E-Value=5.6e-05) Length = 897 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = +1 Query: 127 NFERNAPED*RFMREL-C*RHRRL-RFLVDQLREVECATAEAVHPDGR 264 NF R+ P+ R+ R + RH++ + L+ +++ CA E + P+G+ Sbjct: 243 NFVRSTPKIERYKRVVVAIRHKKQQKLLLKVFKDIRCANLEHLLPEGK 290 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,162,074 Number of Sequences: 59808 Number of extensions: 252456 Number of successful extensions: 645 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -