BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31323 (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 24 2.9 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 5.0 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 23 6.6 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 8.8 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 24.2 bits (50), Expect = 2.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 101 EKKQTKDSETLRGTLQKTDDSCVNFVEGTG 190 +KKQTK ++ ++ KT + C GTG Sbjct: 185 QKKQTKQNKKIQIKHTKTKNGCCRKTCGTG 214 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 5.0 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = +1 Query: 181 RHRRLRFLVDQLREVECATAEAVHPDGRQHDHAQAPQRAAVSALYLHLRGSV 336 R R FL+ + + A E G DH + + SA+++H S+ Sbjct: 1825 RSERQSFLITTIPITQQAAHEPGLDHGPAEDHVEEEEDGTRSAIHMHAAHSL 1876 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 23.0 bits (47), Expect = 6.6 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +2 Query: 116 KDSETLRGTLQKTDDSCVNFVEGTGGYVFSSTNFEKLNA 232 +D E + L+ D+ FV+ G Y F + +L A Sbjct: 2 EDVELISAGLEDDDEGGCYFVDQKGNYYFQANEDAELTA 40 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 22.6 bits (46), Expect = 8.8 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +1 Query: 448 TCDRPASFICNG 483 +CDRP +C+G Sbjct: 594 SCDRPGGLLCSG 605 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 465,209 Number of Sequences: 2352 Number of extensions: 8124 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -