BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31322 (532 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1130 + 24517319-24518149,24519374-24519868,24519954-245201... 28 5.4 11_06_0053 + 19667076-19667774,19668001-19669803,19669911-19669928 27 9.4 07_01_0316 + 2226010-2226256,2226956-2227047,2227143-2227180,222... 27 9.4 >08_02_1130 + 24517319-24518149,24519374-24519868,24519954-24520179, 24520267-24520291,24520925-24521234,24521328-24521888 Length = 815 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -1 Query: 136 IHKVISGDPLRLILGYENRQRVIYLHNM 53 I+K + DP+R L +NR+R++YL + Sbjct: 303 IYKRKNSDPIRYSLLEKNRERIVYLQKL 330 >11_06_0053 + 19667076-19667774,19668001-19669803,19669911-19669928 Length = 839 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 255 NRNCRTISYVMFCLYFNLH*STLYESP 175 NR+CR I + Y NLH +++ E P Sbjct: 510 NRHCRDICNTLHLRYLNLHRTSISEIP 536 >07_01_0316 + 2226010-2226256,2226956-2227047,2227143-2227180, 2227289-2227450,2227540-2227562,2227673-2227744, 2227858-2228025,2228318-2228400,2228533-2228595, 2228735-2228917 Length = 376 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 81 RFSYPRMRRRGSPLMTLCIVYSIIILIAEL 170 R +Y RM++RG PL + YS+I EL Sbjct: 216 RDAYARMKKRGVPLAANQVNYSLIYRTPEL 245 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,627,236 Number of Sequences: 37544 Number of extensions: 165660 Number of successful extensions: 227 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 227 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1178343540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -