BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31322 (532 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 4.5 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 21 7.9 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 21 7.9 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 21 7.9 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 4.5 Identities = 13/57 (22%), Positives = 26/57 (45%) Frame = +3 Query: 90 YPRMRRRGSPLMTLCIVYSIIILIAELVLGFHIK*INVN*NTSRTLRNLLFYNCDYV 260 Y + + +T+ +V++I I ++ + +N RT LFYN D++ Sbjct: 294 YAKHKNNRRVWLTILLVWAISAAIGSPIV------LGLNNTPDRTPDQCLFYNTDFI 344 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.0 bits (42), Expect = 7.9 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 264 CLRNRNCRTISYVMFCLYFNLH*STLYESPIP 169 CL+N SY + +YFNL + Y+ P Sbjct: 98 CLKNSADTISSYFVGKMYFNLIDTKCYKLEHP 129 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.0 bits (42), Expect = 7.9 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 264 CLRNRNCRTISYVMFCLYFNLH*STLYESPIP 169 CL+N SY + +YFNL + Y+ P Sbjct: 103 CLKNSADTISSYFVGKMYFNLIDTKCYKLEHP 134 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.0 bits (42), Expect = 7.9 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 264 CLRNRNCRTISYVMFCLYFNLH*STLYESPIP 169 CL+N SY + +YFNL + Y+ P Sbjct: 103 CLKNSADTISSYFVGKMYFNLIDTKCYKLEHP 134 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,440 Number of Sequences: 438 Number of extensions: 2738 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -