BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31322 (532 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g53550.1 68414.m06076 F-box family protein similar to F-box f... 30 1.1 At2g31470.1 68415.m03844 F-box family protein contains F-box dom... 28 4.5 >At1g53550.1 68414.m06076 F-box family protein similar to F-box family protein TIGR_Ath1:At3g23960 Length = 408 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 192 TLYESPIPTQL*VLLYYRLYIKSSAAIPCVSSLGTKIVR 76 T Y PIP L + + RL ++ A CVS L + I+R Sbjct: 29 TCYFDPIPVDLVINILSRLSLECIARCRCVSKLWSSIIR 67 >At2g31470.1 68415.m03844 F-box family protein contains F-box domain Pfam:PF00646 Length = 387 Score = 27.9 bits (59), Expect = 4.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 177 PIPTQL*VLLYYRLYIKSSAAIPCVSSLGTKIVR 76 PIP L + ++ R +KS A CVS L I+R Sbjct: 24 PIPIDLVIEIFSRSPVKSIARCRCVSKLWASILR 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,254,596 Number of Sequences: 28952 Number of extensions: 153350 Number of successful extensions: 252 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 252 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 987020800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -