BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31320 (611 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 25 0.58 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 25 0.58 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 25 0.58 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 24 1.3 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 24 1.3 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 24 1.3 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 24 1.3 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 24 1.3 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 24 1.3 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 24 1.3 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 24 1.3 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 24 1.3 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 24 1.3 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 24 1.3 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 24 1.3 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 24 1.3 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 23 2.4 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 23 2.4 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 23 2.4 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 23 2.4 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 3.1 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 22 4.1 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 22 4.1 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 22 4.1 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 22 4.1 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 4.1 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 4.1 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 4.1 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 4.1 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 5.4 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 5.4 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 5.4 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 9.5 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 9.5 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 9.5 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 25.0 bits (52), Expect = 0.58 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRERWHRKRKHQGQ 611 RR +L L + R SRK R+REQNS KN + ++ + K + + Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSY-KNEKEYRKYRERSKERSR 68 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 25.0 bits (52), Expect = 0.58 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRERWHRKRKHQGQ 611 RR +L L + R SRK R+REQNS KN + ++ + K + + Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSY-KNEKEYRKYRERSKERSR 68 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 25.0 bits (52), Expect = 0.58 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRERWHRKRK 599 RR +L L + R SRK R+REQNS R+ R+ R ++ Sbjct: 250 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRERSKE 298 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R SRK R+REQNS R+ R+ Sbjct: 239 RRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 280 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.0 bits (47), Expect = 2.4 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRERWHRKRKHQGQ 611 RR +L L + R SRK R+REQ S KN + ++ K + Q Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQKSY-KNEREYRKYRETSKERSQ 68 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.0 bits (47), Expect = 2.4 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRERWHRKRKHQGQ 611 RR +L L + R SRK R+REQ S KN + ++ K + Q Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQKSY-KNEREYRKYRETSKERSQ 68 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.4 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R +RK R+REQNS R+ R+ Sbjct: 16 RRYEKLHNEKEKLLEERTNRKRNSRSREREQNSYKNEREYRK 57 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.4 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 RR +L L + R +RK R+REQNS R+ R+ Sbjct: 16 RRYEKLHNEKEKLLEERTNRKRNSRSREREQNSYKNEREYRK 57 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.1 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRERWHRKRKHQGQ 611 RR +L L + R SRK R+REQ S KN + ++ + K + + Sbjct: 17 RRYEKLHNEKEKLLEERTSRKRYSRSREREQKSY-KNERKYRKYRERSKERSR 68 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 R+ +L + L + R SRK R+REQNS R+ R+ Sbjct: 17 RQYEKLCNEEEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 R+ +L + L + R SRK R+REQNS R+ R+ Sbjct: 17 RQYEKLCNEEEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 R+ +L + L + R SRK R+REQNS R+ R+ Sbjct: 17 RQYEKLCNEEEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 R+ +L + L + R SRK R+REQNS R+ R+ Sbjct: 17 RQYEKLCNEEEKLLEERTSRKRYSRSREREQNSYKNEREYRK 58 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 4.1 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRERWHRKRKHQGQ 611 R+ +L L + R SRK R+REQNS KN + ++ K + + Sbjct: 17 RQYEKLHNEKEKLLEERTSRKRYSRSREREQNSY-KNEKEYRKYRETSKERSR 68 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.2 bits (45), Expect = 4.1 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRERWHRKRKHQGQ 611 RR +L L + R SRK R+REQ S KN + ++ + K + + Sbjct: 17 RRYEKLYNEKEKLLEERTSRKRYSRSREREQKSY-KNERKYRKYRERSKERSR 68 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 4.1 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 R+ +L L + R SRK R+REQNS R+ R+ Sbjct: 239 RQYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 280 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.1 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 453 RRRLRLQIRDHPLRQ*RRSRKLPLLVRDREQNSR*KNRQGRE 578 R+ +L L + R SRK R+REQNS R+ R+ Sbjct: 250 RQYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRK 291 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 360 HDGQGNNAGSLVSITKVFA 304 H G G N G + ITK+ A Sbjct: 148 HTGVGRNVGYKIPITKLTA 166 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 360 HDGQGNNAGSLVSITKVFA 304 H G G N G + ITK+ A Sbjct: 148 HTGVGRNVGYKIPITKLTA 166 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 360 HDGQGNNAGSLVSITKVFA 304 H G G N G + ITK+ A Sbjct: 148 HTGVGRNVGYKIPITKLTA 166 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 606 LDAFVFGANVLDLAG 562 L AF+FGAN L G Sbjct: 53 LSAFLFGANALFTPG 67 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 9.5 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = +1 Query: 19 LSLTVALAAETGKYTPFQYNRVYSTVSPFVYKPGRYVADPGRYDPSRDNSGRYIPDNS 192 ++LT+A +T K P N + ++Y + R + NS + + DNS Sbjct: 295 MNLTLAKMEKTSKPLPMVDNPESTGNLVYIYNNPFSDVEERRVSKTAMNSNQIVSDNS 352 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 303 QQIPW*CLQGIQHCS 347 QQI W L+ IQ CS Sbjct: 557 QQIAWMALKMIQACS 571 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.312 0.133 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,875 Number of Sequences: 438 Number of extensions: 3358 Number of successful extensions: 35 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -