BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31320 (611 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g22080.1 68418.m02571 DNAJ heat shock N-terminal domain-conta... 35 0.037 At1g11680.1 68414.m01341 obtusifoliol 14-demethylase (CYP51) ide... 28 4.2 At5g64280.1 68418.m08075 oxoglutarate/malate translocator, putat... 27 7.4 At3g13180.1 68416.m01649 NOL1/NOP2/sun family protein / antiterm... 27 7.4 At3g13400.1 68416.m01685 multi-copper oxidase type I family prot... 27 9.8 >At5g22080.1 68418.m02571 DNAJ heat shock N-terminal domain-containing protein similar to J-domain protein Jiv [Bos taurus] GI:15777193; contains Pfam profile PF00226 DnaJ domain Length = 246 Score = 35.1 bits (77), Expect = 0.037 Identities = 22/86 (25%), Positives = 42/86 (48%) Frame = +3 Query: 354 RREAYHSRASHTHIRCQQGGHTHIRCQQGGPTQRRRLRLQIRDHPLRQ*RRSRKLPLLVR 533 +++ AS +G H HI +Q Q+ L+L++R+ Q R RK+ + + Sbjct: 114 KKQLKKDTASKIKSLVDEGKHEHIY-EQSEEFQKE-LKLKVREILTDQEWRRRKMAMRIS 171 Query: 534 DREQNSR*KNRQGRERWHRKRKHQGQ 611 + E + + +E W +KR+H+ Q Sbjct: 172 EEEGRLKKDEAEQKEIWKKKREHEEQ 197 >At1g11680.1 68414.m01341 obtusifoliol 14-demethylase (CYP51) identical to obtusifoliol 14-demethylase (GI:14624983) [Arabidopsis thaliana] Length = 488 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = +1 Query: 34 ALAAETGKYTPFQYNRVYSTVSPFVYKPGRYVADPGRYDPSRDNSGRYIPDNSGAYN 204 ++ A GK + +T F + DP YDP R + GR +GA++ Sbjct: 366 SVTARDGKTYDIPKGHIVATSPAFANRLPHIFKDPDTYDPERFSPGREEDKAAGAFS 422 >At5g64280.1 68418.m08075 oxoglutarate/malate translocator, putative similar to SWISS-PROT:Q41364 2-oxoglutarate/malate translocator, chloroplast precursor [Spinach]{Spinacia oleracea} Length = 549 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 600 AFVFGANVLDLAGFFSENFVLGLVQVVV 517 A +GA +DL F FV+ LVQ ++ Sbjct: 507 ALYYGAGYVDLRDMFRVGFVMALVQAII 534 >At3g13180.1 68416.m01649 NOL1/NOP2/sun family protein / antitermination NusB domain-containing protein low similarity to SP|P36929 SUN protein (FMU protein) {Escherichia coli}; contains Pfam profiles PF01189: NOL1/NOP2/sun family, PF01029: NusB family Length = 523 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 7 LAICLSLTVALAAETGKYTPFQYNRVYSTVSPF 105 +A LS V L+AET K +P + R T PF Sbjct: 1 MAQLLSFRVYLSAETQKASPGSFKRTQKTRKPF 33 >At3g13400.1 68416.m01685 multi-copper oxidase type I family protein similar to pollen-specific BP10 protein [SP|Q00624][Brassica napus]; contains Pfam profile: PF00394 Multicopper oxidase Length = 551 Score = 27.1 bits (57), Expect = 9.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 13 ICLSLTVALAAETGKYTPFQYNRVYSTVSP 102 +CL+ TVAL + Y + +N Y T +P Sbjct: 11 VCLASTVALVSAGDPYFYYTWNVTYGTAAP 40 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.312 0.133 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,539,406 Number of Sequences: 28952 Number of extensions: 211169 Number of successful extensions: 503 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -