BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31315 (356 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0083 + 16374830-16374922,16375917-16375974,16377893-163780... 28 2.5 03_01_0206 - 1625020-1625619,1625722-1625931,1626054-1626094,162... 27 5.7 04_03_0652 - 18424489-18424525,18424639-18424702,18424796-184248... 26 7.6 02_05_0709 - 31111834-31111887,31111910-31112134 26 7.6 02_03_0212 - 16460665-16460766,16460971-16461298,16461379-164615... 26 7.6 01_07_0309 - 42655890-42656001,42656241-42656332,42656493-426565... 26 7.6 >06_03_0083 + 16374830-16374922,16375917-16375974,16377893-16378089, 16378176-16378292,16378437-16378497,16378603-16378691, 16378808-16378882,16378992-16379080,16379203-16379252, 16379539-16379699,16380004-16380132,16380548-16380928 Length = 499 Score = 27.9 bits (59), Expect = 2.5 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 8 VRFKKEKKTVVFINCHFFAFCVNNYRFRYFIQTYFVKR 121 ++ KK KK N + F ++ RFR+ QT FVKR Sbjct: 154 LKMKKWKKWESQTNSLEYQFAIDPSRFRFTHQTSFVKR 191 >03_01_0206 - 1625020-1625619,1625722-1625931,1626054-1626094, 1626185-1626234,1626345-1626433,1626534-1626608, 1626721-1626806,1626896-1626956,1627090-1627206, 1627308-1627549,1627983-1628040,1628162-1628284 Length = 583 Score = 26.6 bits (56), Expect = 5.7 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 8 VRFKKEKKTVVFINCHFFAFCVNNYRFRYFIQTYFVKR 121 ++ KK KK + N + F + RFR+ QT FVKR Sbjct: 179 LKMKKWKKWELETNSLEYQFANDPSRFRFTHQTSFVKR 216 >04_03_0652 - 18424489-18424525,18424639-18424702,18424796-18424869, 18425809-18425924,18426078-18426343,18427659-18427749 Length = 215 Score = 26.2 bits (55), Expect = 7.6 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 6/28 (21%) Frame = +3 Query: 123 GFIQFLFYISHFYYY------NLRVSLP 188 GF+Q L Y FYYY N++++LP Sbjct: 187 GFVQTLLYADFFYYYLNSLKNNVKLTLP 214 >02_05_0709 - 31111834-31111887,31111910-31112134 Length = 92 Score = 26.2 bits (55), Expect = 7.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 5 GVRFKKEKKTVVFINCHFFAFC 70 G K E+ TV+F +C FF C Sbjct: 19 GAILKDERGTVIFSSCRFFERC 40 >02_03_0212 - 16460665-16460766,16460971-16461298,16461379-16461502, 16461576-16461825,16462185-16462265,16463030-16463114, 16463200-16463321,16463865-16464672,16464775-16465027, 16465998-16466796 Length = 983 Score = 26.2 bits (55), Expect = 7.6 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 5 GVRFKKEKKTVVFINCHFFA 64 G+R + +++ F+NCHF A Sbjct: 693 GLRMRIHDRSICFVNCHFAA 712 >01_07_0309 - 42655890-42656001,42656241-42656332,42656493-42656500, 42658146-42658209,42658408-42658473,42658479-42658571 Length = 144 Score = 26.2 bits (55), Expect = 7.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 31 NCSFYKLSFFCILCK*LSFSVL 96 N +F ++ F C LCK + FS+L Sbjct: 25 NANFLQMFFLCKLCKFVVFSIL 46 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,504,644 Number of Sequences: 37544 Number of extensions: 114047 Number of successful extensions: 160 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 542368620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -