Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31315
         (356 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-2575|AAF55590.1|  218|Drosophila melanogaster CG7715-PA...    27   5.3  

>AE014297-2575|AAF55590.1|  218|Drosophila melanogaster CG7715-PA
           protein.
          Length = 218

 Score = 27.5 bits (58), Expect = 5.3
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 2/36 (5%)
 Frame = -1

Query: 317 ALYIIFMISISRKRLQYTLRCNRR--SIRPKKYKIN 216
           AL  + ++++S+ RL YTL+C R   SIR   Y  N
Sbjct: 5   ALCFLSLLALSQARLDYTLQCARGEISIRWPSYHSN 40


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,498,838
Number of Sequences: 53049
Number of extensions: 225427
Number of successful extensions: 431
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 430
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 431
length of database: 24,988,368
effective HSP length: 76
effective length of database: 20,956,644
effective search space used: 880179048
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)