BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31313 (612 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_22307| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_52550| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_264| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_35291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_3898| Best HMM Match : CITED (HMM E-Value=1.5) 28 6.9 SB_43370| Best HMM Match : RhoGAP (HMM E-Value=1.6e-18) 27 9.1 SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) 27 9.1 >SB_29939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 399 NGVVFIVDNDIYTIFANGTSEKTD 328 N VVF+VDN +Y + N T TD Sbjct: 95 NEVVFVVDNTVYQRYHNNTKTVTD 118 >SB_22307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 713 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -3 Query: 502 QKAESCDRKWGAGNRWPSRKPSSGEANQTTVCHRKRC 392 Q A CDR GN+W +G A T+ KRC Sbjct: 44 QNALRCDRNEFPGNQWYRFTGQAGNAMPTSCVPEKRC 80 >SB_52550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -3 Query: 502 QKAESCDRKWGAGNRWPSRKPSSGEANQTTVCHRKRC 392 Q A CDR GN+W +G A T+ KRC Sbjct: 176 QNALRCDRNEFPGNQWYRFTGQAGNAMPTSCVPEKRC 212 >SB_264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -3 Query: 502 QKAESCDRKWGAGNRWPSRKPSSGEANQTTVCHRKRC 392 Q A CD+ GN+W +G+A T+ KRC Sbjct: 20 QNALRCDKNEFPGNQWYRFTGQAGDAMPTSCVPEKRC 56 >SB_35291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -3 Query: 502 QKAESCDRKWGAGNRWPSRKPSSGEANQTTVCHRKRC 392 Q A CD+ GN+W +G+A T+ KRC Sbjct: 20 QNALRCDKNEFPGNQWYRFTGQAGDAMPTSCVPEKRC 56 >SB_3898| Best HMM Match : CITED (HMM E-Value=1.5) Length = 1166 Score = 27.9 bits (59), Expect = 6.9 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +2 Query: 368 MSLSTIKTTPFSMTNGGLISLT*AGFSG-RPTISCTPFSVTTF--GFLSGP 511 +SLS + TTP S + S A S P +S PFS TF F SGP Sbjct: 617 VSLSVV-TTPCSSWTRSVFSWMTASISAIDPIVSLKPFSFATFQRSFASGP 666 >SB_43370| Best HMM Match : RhoGAP (HMM E-Value=1.6e-18) Length = 865 Score = 27.5 bits (58), Expect = 9.1 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = -2 Query: 215 SYLMN*KHFWKRRLKIYSRSRPDHAADSEPEHL 117 SY + K F KRR S P +AA SEPE L Sbjct: 350 SYRLRRKIFGKRRGVFSSEKSPFYAAKSEPELL 382 >SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) Length = 3369 Score = 27.5 bits (58), Expect = 9.1 Identities = 30/113 (26%), Positives = 50/113 (44%), Gaps = 8/113 (7%) Frame = -1 Query: 564 AKDAQQIMLDYSDNVYFYGPDKKPKVVTENGV------QEIVGLPENPAQVRLIKPPFVI 403 A+D +LD+ DN + D +P +++ N Q GL RL + + Sbjct: 1379 AQDVADRVLDFDDNFDLFSLDFRPFLLSANDFDRVSAGQSTSGLQGAKLMGRLYESTTLT 1438 Query: 402 ENGVVFIVDNDIYTIFANGT-SEKTDFKLDAKP-TASAVEATLIQYYAYNKNI 250 E + + +D+ TI N T + + + +L K T+ V TL +NKNI Sbjct: 1439 EEASPYEITSDV-TILPNVTLTIEPNVELKFKAGTSLLVLGTLNAKGTFNKNI 1490 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,201,728 Number of Sequences: 59808 Number of extensions: 343370 Number of successful extensions: 1145 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1075 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1143 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -