BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31311 (616 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.4 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.4 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 23 3.1 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 7.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 9.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.6 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 226 LRVAPEEHPVLLTEAPLNPKANREKM 303 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.4 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -2 Query: 588 LLDVTNDFPLSGGGERVTPLGEDLHEVVGQVATSQVQTEDGVGQS-VTFVDGYGVGDT 418 ++D+T S G+ V +L+ +VG A + E+G G + VT + + DT Sbjct: 18 MVDLTQCLQESSTGQSVEFSPMELNALVGTPAAPNMPAEEGEGMAGVTGEEPFDTLDT 75 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 234 DTQLIVEGVVPDLLHVI 184 + Q +V+ V PD+LH+I Sbjct: 21 NNQTVVDKVPPDMLHLI 37 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = -3 Query: 401 TIPVVRPEAYSESTAWMATYMAGELKVSNMIWVIFSL 291 T+P + E + AWM G L+ N + F + Sbjct: 33 TLPGYKIECVGDDIAWMKFDKEGRLRAINPEYGFFGV 69 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +1 Query: 424 SHTVPIYEGYALPHAILRLDLAGRDLTDYLMKI 522 +H + Y GY P + D A + T+ MK+ Sbjct: 187 NHQLISYAGYKNPDGTIIGDPANIEFTELCMKL 219 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 420 CLPHRTHLRRLRSAPRHPPS 479 C P +L ++ S P HPP+ Sbjct: 79 CDPVPGNLEQIGSRPLHPPA 98 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,860 Number of Sequences: 438 Number of extensions: 3292 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -