BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31310 (488 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0187 + 7611922-7614099,7614692-7614795,7614828-7614996 29 2.6 03_02_0672 - 10325935-10326150,10326308-10326400,10326568-103267... 28 3.5 04_04_0436 + 25186144-25187915,25188020-25188077,25188472-25188888 27 8.1 >02_02_0187 + 7611922-7614099,7614692-7614795,7614828-7614996 Length = 816 Score = 28.7 bits (61), Expect = 2.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 256 HRAVSERRLKSLVGQWC 306 HR V R L+SL+ QWC Sbjct: 348 HRLVPNRALRSLISQWC 364 >03_02_0672 - 10325935-10326150,10326308-10326400,10326568-10326708, 10326828-10326893,10327099-10327359 Length = 258 Score = 28.3 bits (60), Expect = 3.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 195 LLRQ*KISNKKNAKFTISRYYEELCPW 115 LL + KK K ++ YYE LCP+ Sbjct: 18 LLAAGAVEGKKGGKVDVALYYESLCPY 44 >04_04_0436 + 25186144-25187915,25188020-25188077,25188472-25188888 Length = 748 Score = 27.1 bits (57), Expect = 8.1 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Frame = -3 Query: 174 SNKKNAKFTISRYYEELC---PWFI--YIFFFMSVHT*NCYEIDFDAFIKIHSL 28 S+ + K + ++ EE+C W + YI+ ++ T +C DFD + + SL Sbjct: 463 SDVLDGKANLRKFIEEVCLTLEWTVNQYIYCVDALETVDCITNDFDGNVSLRSL 516 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,841,937 Number of Sequences: 37544 Number of extensions: 186773 Number of successful extensions: 291 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 291 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1011709100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -