BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31306 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 27 0.57 AY146744-1|AAO12104.1| 176|Anopheles gambiae odorant-binding pr... 25 3.0 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 27.1 bits (57), Expect = 0.57 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -3 Query: 164 VVELRRGQSRLAAQLVQAHESVVRPRYRLAVVASKRRRLVVQS 36 + + RR LA +L H+S+ R+ + SKR+ +++Q+ Sbjct: 901 MAKARREVQALAKELAAIHQSIANIESRIESMKSKRQTILMQA 943 >AY146744-1|AAO12104.1| 176|Anopheles gambiae odorant-binding protein AgamOBP8 protein. Length = 176 Score = 24.6 bits (51), Expect = 3.0 Identities = 14/47 (29%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 27 YPITLNDETASLRSDHSQSVARTYNGLVCLDELCCQ--AGLSASQLD 161 YP+ N S+ H V RT+ + C Q AG +S +D Sbjct: 35 YPVLRNSTPFSIFQTHGAYVVRTFADATAYRDECVQQYAGRGSSLID 81 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,981 Number of Sequences: 2352 Number of extensions: 12038 Number of successful extensions: 95 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -