BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31306 (700 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC056861-1|AAH56861.1| 380|Homo sapiens tumor suppressor candid... 50 8e-06 BC021984-1|AAH21984.1| 380|Homo sapiens tumor suppressor candid... 50 8e-06 AF040707-1|AAC62535.1| 380|Homo sapiens candidate tumor suppres... 50 8e-06 AC002481-3|AAB67310.1| 380|Homo sapiens WUGSC:H_LUCA12.3 protein. 50 8e-06 >BC056861-1|AAH56861.1| 380|Homo sapiens tumor suppressor candidate 4 protein. Length = 380 Score = 50.0 bits (114), Expect = 8e-06 Identities = 26/61 (42%), Positives = 36/61 (59%) Frame = +3 Query: 6 LIRRVYKYPITLNDETASLRSDHSQSVARTYNGLVCLDELCCQAGLSASQLDDQLERDTN 185 LIRR+ KYP+ + E S H AR Y G DE+CC+ G+S +LD++LE D N Sbjct: 322 LIRRLQKYPVRVTREEQS----HP---ARLYTGCHSYDEICCKTGMSYHELDERLENDPN 374 Query: 186 V 188 + Sbjct: 375 I 375 >BC021984-1|AAH21984.1| 380|Homo sapiens tumor suppressor candidate 4 protein. Length = 380 Score = 50.0 bits (114), Expect = 8e-06 Identities = 26/61 (42%), Positives = 36/61 (59%) Frame = +3 Query: 6 LIRRVYKYPITLNDETASLRSDHSQSVARTYNGLVCLDELCCQAGLSASQLDDQLERDTN 185 LIRR+ KYP+ + E S H AR Y G DE+CC+ G+S +LD++LE D N Sbjct: 322 LIRRLQKYPVRVTREEQS----HP---ARLYTGCHSYDEICCKTGMSYHELDERLENDPN 374 Query: 186 V 188 + Sbjct: 375 I 375 >AF040707-1|AAC62535.1| 380|Homo sapiens candidate tumor suppressor gene 21 protein isoform I protein. Length = 380 Score = 50.0 bits (114), Expect = 8e-06 Identities = 26/61 (42%), Positives = 36/61 (59%) Frame = +3 Query: 6 LIRRVYKYPITLNDETASLRSDHSQSVARTYNGLVCLDELCCQAGLSASQLDDQLERDTN 185 LIRR+ KYP+ + E S H AR Y G DE+CC+ G+S +LD++LE D N Sbjct: 322 LIRRLQKYPVRVTREEQS----HP---ARLYTGCHSYDEICCKTGMSYHELDERLENDPN 374 Query: 186 V 188 + Sbjct: 375 I 375 >AC002481-3|AAB67310.1| 380|Homo sapiens WUGSC:H_LUCA12.3 protein. Length = 380 Score = 50.0 bits (114), Expect = 8e-06 Identities = 26/61 (42%), Positives = 36/61 (59%) Frame = +3 Query: 6 LIRRVYKYPITLNDETASLRSDHSQSVARTYNGLVCLDELCCQAGLSASQLDDQLERDTN 185 LIRR+ KYP+ + E S H AR Y G DE+CC+ G+S +LD++LE D N Sbjct: 322 LIRRLQKYPVRVTREEQS----HP---ARLYTGCHSYDEICCKTGMSYHELDERLENDPN 374 Query: 186 V 188 + Sbjct: 375 I 375 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,903,665 Number of Sequences: 237096 Number of extensions: 1713046 Number of successful extensions: 4096 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4089 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -