BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31306 (700 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051914-1|AAK93338.1| 412|Drosophila melanogaster LD40282p pro... 48 2e-05 AE014298-2495|AAF48677.1| 412|Drosophila melanogaster CG9104-PA... 48 2e-05 >AY051914-1|AAK93338.1| 412|Drosophila melanogaster LD40282p protein. Length = 412 Score = 47.6 bits (108), Expect = 2e-05 Identities = 25/65 (38%), Positives = 37/65 (56%) Frame = +3 Query: 9 IRRVYKYPITLNDETASLRSDHSQSVARTYNGLVCLDELCCQAGLSASQLDDQLERDTNV 188 IR ++KYP+ T S+ S + Y GL+ DE+CC+ GLS ++ +E+DTNV Sbjct: 356 IRCIHKYPVF----TGSVPSGRQ----KMYTGLISFDEICCKTGLSPCTIERDIEKDTNV 407 Query: 189 AFIVK 203 I K Sbjct: 408 TVIWK 412 >AE014298-2495|AAF48677.1| 412|Drosophila melanogaster CG9104-PA protein. Length = 412 Score = 47.6 bits (108), Expect = 2e-05 Identities = 25/65 (38%), Positives = 37/65 (56%) Frame = +3 Query: 9 IRRVYKYPITLNDETASLRSDHSQSVARTYNGLVCLDELCCQAGLSASQLDDQLERDTNV 188 IR ++KYP+ T S+ S + Y GL+ DE+CC+ GLS ++ +E+DTNV Sbjct: 356 IRCIHKYPVF----TGSVPSGRQ----KMYTGLISFDEICCKTGLSPCTIERDIEKDTNV 407 Query: 189 AFIVK 203 I K Sbjct: 408 TVIWK 412 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,472,835 Number of Sequences: 53049 Number of extensions: 533689 Number of successful extensions: 1425 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1425 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3067209849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -