BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31301 (541 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC83.10 |||conserved eukaryotic protein|Schizosaccharomyces po... 27 1.8 SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyc... 26 3.1 SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces... 25 7.2 SPCC4B3.04c |nte1||lysophospholipase|Schizosaccharomyces pombe|c... 25 7.2 SPCC191.11 |inv1||beta-fructofuranosidase|Schizosaccharomyces po... 25 9.5 >SPBC83.10 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 189 Score = 27.1 bits (57), Expect = 1.8 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 394 FFLRIQSINLSFVYFSIQI*ELVVYHHH 311 +FLR++SI+ F F I I E +VY ++ Sbjct: 77 YFLRLESIDYEFSEFHIIINESIVYPYY 104 >SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1238 Score = 26.2 bits (55), Expect = 3.1 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 335 LNLDRKVNE*EINRLNSKKEFDGVSAKVTDLMQSTLLSSCF 457 L+L+ K+ + E+N+ KK+F G + D +L+SS F Sbjct: 387 LSLELKLMQNELNKGQLKKQFKGDLRNLADWNNLSLVSSKF 427 >SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 967 Score = 25.0 bits (52), Expect = 7.2 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 445 LQLFFLKIWNNAGGL 489 L+L+FLKIW A G+ Sbjct: 917 LRLYFLKIWKEAKGM 931 >SPCC4B3.04c |nte1||lysophospholipase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1316 Score = 25.0 bits (52), Expect = 7.2 Identities = 7/26 (26%), Positives = 17/26 (65%) Frame = -2 Query: 372 LISHSFTFRSKFKNL*FTIIIEVCIM 295 ++++S T + FK+L F + +C++ Sbjct: 53 IVTYSLTIQFNFKSLLFLFFVSICVV 78 >SPCC191.11 |inv1||beta-fructofuranosidase|Schizosaccharomyces pombe|chr 3|||Manual Length = 581 Score = 24.6 bits (51), Expect = 9.5 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -2 Query: 402 PSNSFFEFNLLISHSFT 352 PSN+ FEFN+ +S ++T Sbjct: 438 PSNTAFEFNVTLSINYT 454 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,757,281 Number of Sequences: 5004 Number of extensions: 28069 Number of successful extensions: 68 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 221892220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -