BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31301 (541 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 22 3.5 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 4.6 X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 21 6.1 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 21 6.1 AF442148-1|AAL35349.1| 199|Apis mellifera apidaecin precursor p... 21 6.1 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 22.2 bits (45), Expect = 3.5 Identities = 12/51 (23%), Positives = 22/51 (43%) Frame = +2 Query: 302 HTSMMMVNYKFLNLDRKVNE*EINRLNSKKEFDGVSAKVTDLMQSTLLSSC 454 + M+ F+N D NE + +K + + V+ V + T +SC Sbjct: 62 YVDCMLKKVGFVNADTTFNEEKFRERTTKLDSEQVNRLVNNCKDITESNSC 112 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.8 bits (44), Expect = 4.6 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +2 Query: 266 SIPVPGAGDDI 298 S+P+PGA DD+ Sbjct: 477 SLPLPGADDDL 487 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 21.4 bits (43), Expect = 6.1 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -1 Query: 271 NRTRYFPQVTSYAPKLTRNEKKKTSQSTN 185 NR Y PQ P+L R K + N Sbjct: 240 NRPVYIPQPRPPHPRLRREAKPEAKPGNN 268 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 21.4 bits (43), Expect = 6.1 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -1 Query: 271 NRTRYFPQVTSYAPKLTRNEKKKTSQSTN 185 NR Y PQ P+L R + K N Sbjct: 45 NRPIYIPQPRPPHPRLRREAEPKAEPGNN 73 >AF442148-1|AAL35349.1| 199|Apis mellifera apidaecin precursor protein. Length = 199 Score = 21.4 bits (43), Expect = 6.1 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -1 Query: 271 NRTRYFPQVTSYAPKLTRNEKKKTSQSTN 185 NR Y PQ P+L R K + N Sbjct: 128 NRPVYIPQPRPPHPRLRREAKPEAEPGNN 156 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,851 Number of Sequences: 438 Number of extensions: 1701 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -