BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31299 (707 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 96 3e-22 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 6.6 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 6.6 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 8.7 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 8.7 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 8.7 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 8.7 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 8.7 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 8.7 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 96.3 bits (229), Expect = 3e-22 Identities = 51/112 (45%), Positives = 66/112 (58%), Gaps = 1/112 (0%) Frame = +2 Query: 68 EADAQIVSQDADV-FPDKYQYQYQTSNGISGQEQGALVNEGREDASIAVQGSSGYTAPDG 244 + DA I SQ +V F Y ++TSNGIS QE G E ++ QGS YTAPDG Sbjct: 24 DKDAVITSQQLEVNFDGNYINNFETSNGISHQESGQPKQVDNETPVVS-QGSDSYTAPDG 82 Query: 245 TPIQITYIADANGYQPSGAHLPTTPAPLPIPDYIARAIEYIRTHPPKPEVGQ 400 + ITY+AD NG+Q G+H+PT P PIP I RA+E+ HP + + GQ Sbjct: 83 QQVSITYVADENGFQVQGSHIPTAP---PIPPEIQRALEWNAAHPEEDDGGQ 131 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/19 (47%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Frame = -1 Query: 611 KRRPVNCNTTHYR-GELGT 558 K++P +C+T YR GE+ T Sbjct: 565 KKQPSDCDTLEYRNGEVTT 583 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 213 WTAMDASSRPSFTSAPCSWPL 151 WTA +A + FTSA W + Sbjct: 804 WTAPEAIAFRKFTSASDVWSM 824 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 487 TRHINDRQCYGLRCFNNSRPYQLSYN 410 +RH + GL C N + Y S+N Sbjct: 1454 SRHATSHELKGLLCGNTYQLYLTSHN 1479 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 487 TRHINDRQCYGLRCFNNSRPYQLSYN 410 +RH + GL C N + Y S+N Sbjct: 1450 SRHATSHELKGLLCGNTYQLYLTSHN 1475 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 460 YGLRCFNNSRPYQLSYNLNTLADL 389 Y +NN+ QL YN+N + + Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQI 112 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 460 YGLRCFNNSRPYQLSYNLNTLADL 389 Y +NN+ QL YN+N + + Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQI 112 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 460 YGLRCFNNSRPYQLSYNLNTLADL 389 Y +NN+ QL YN+N + + Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQI 112 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 460 YGLRCFNNSRPYQLSYNLNTLADL 389 Y +NN+ QL YN+N + + Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQI 112 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 460 YGLRCFNNSRPYQLSYNLNTLADL 389 Y +NN+ QL YN+N + + Sbjct: 89 YNYSNYNNNNYKQLCYNINHIEQI 112 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 460 YGLRCFNNSRPYQLSYNLNTLADL 389 Y +NN+ QL YN+N + + Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQI 112 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,606 Number of Sequences: 438 Number of extensions: 4410 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -