BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31295 (757 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 24 4.4 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 23 7.7 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 23 7.7 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 24.2 bits (50), Expect = 4.4 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 4/25 (16%) Frame = +1 Query: 82 KLLPIYLNGSIEDA--TR--FHCND 144 KLL +Y +G +ED+ TR +HC D Sbjct: 171 KLLKVYASGKVEDSPETRCLYHCID 195 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 23.4 bits (48), Expect = 7.7 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 162 ECTLFVYKRSVSSTFYNFKNKSR*IKLKNNRSLF 263 +C ++KR + +Y +KN KL N S F Sbjct: 107 KCAKLIHKRHGFNAWYGWKNHCNGKKLPNVSSCF 140 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 23.4 bits (48), Expect = 7.7 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 162 ECTLFVYKRSVSSTFYNFKNKSR*IKLKNNRSLF 263 +C ++KR + +Y +KN KL N S F Sbjct: 107 KCAKLIHKRHGFNAWYGWKNHCNGKKLPNVSSCF 140 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 802,151 Number of Sequences: 2352 Number of extensions: 17685 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -