BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31289 (616 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) 32 0.32 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 31 0.74 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 31 0.98 SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) 29 2.3 SB_2413| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 28 6.9 SB_22747| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) 28 6.9 SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) 27 9.1 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 34.3 bits (75), Expect = 0.080 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = +1 Query: 445 IEEKRQRLEEAEKKRQAMLQAMKDA 519 +EE+R+RLE EK+RQA QAM++A Sbjct: 319 LEEERKRLENLEKERQAAQQAMQEA 343 >SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) Length = 1168 Score = 32.3 bits (70), Expect = 0.32 Identities = 16/55 (29%), Positives = 33/55 (60%) Frame = +1 Query: 442 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTK 606 ++EEK++RL+ E+ + ++ +A K+ASK+ + T + +S N ++ T K Sbjct: 427 EVEEKKRRLQRYERLQSSLNEAYKEASKSSVDGT-RDESRNEEITQTSCNETSGK 480 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 31.1 bits (67), Expect = 0.74 Identities = 20/56 (35%), Positives = 32/56 (57%) Frame = +1 Query: 445 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 +EE+R+R EEAEKKR+ + ++ + + KK E L QLER K +++ Sbjct: 252 MEEERKRKEEAEKKREEEERKRREEEEAAQKW---KKEEL--LRQQQLEREKEEQE 302 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 30.7 bits (66), Expect = 0.98 Identities = 16/39 (41%), Positives = 26/39 (66%) Frame = +1 Query: 448 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSEN 564 EE+RQ+ EEA K+R+ L A K++SK+ +++S N Sbjct: 1344 EERRQKREEARKRREEKL-AKKESSKSSNKRKSKERSGN 1381 >SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2391 Score = 30.7 bits (66), Expect = 0.98 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +3 Query: 498 APGHE--RCQQDRTQLHHPKEERKLRFEQ 578 APGH+ RC QD +L+ K ERK R EQ Sbjct: 1105 APGHQPLRCLQDVEELYLSKVERKDRLEQ 1133 >SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) Length = 729 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = +1 Query: 442 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQL 615 D+EEK + LEEA+ + +A+ MKD + + S L +Q + T+ + L Sbjct: 522 DLEEKAKELEEAKSENEAISGKMKDMESQLTSIADELASTKEALKLSQHKVTELESSL 579 >SB_2413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = +1 Query: 178 PAPKQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQRA 297 PA ++EGEG+P+ +R+ Q + ++Q K + +K ++ Sbjct: 56 PANEEEGEGEPKPKRRKAQPSAPKEKQTKSRKRDKKKDKS 95 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +1 Query: 448 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSE 561 EE+R++ EEAE++R+ + K + +QK+ + Sbjct: 636 EERRRQQEEAERQRREQEEVFKQQEQQRQQLELQKRQQ 673 >SB_22747| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) Length = 337 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 379 RGAFLLRHEKPCAWPASL*GV 317 RGA L R+E PC W A L G+ Sbjct: 69 RGAALQRNEPPCMWIAILNGI 89 >SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) Length = 1078 Score = 27.5 bits (58), Expect = 9.1 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +1 Query: 448 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNA 582 EE+RQ+ EEA K+R+ L + T + ++K G S A Sbjct: 537 EERRQKREEARKRREEKLAKKGPTTSTSSSRKRRRKFNRNGRSAA 581 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.129 0.365 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,273,266 Number of Sequences: 59808 Number of extensions: 196551 Number of successful extensions: 775 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -